KEGG   Homo sapiens (human): 10528
Entry
10528             CDS       T01001                                 
Symbol
NOP56, NOL5A, SCA36
Name
(RefSeq) NOP56 ribonucleoprotein
  KO
K14564  nucleolar protein 56
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa05017  Spinocerebellar ataxia
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    10528 (NOP56)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    10528 (NOP56)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    10528 (NOP56)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    10528 (NOP56)
 Prokaryotic type
    10528 (NOP56)
SSDB
Motif
Pfam: Nop NOP5NT
Other DBs
NCBI-GeneID: 10528
NCBI-ProteinID: NP_006383
OMIM: 614154
HGNC: 15911
Ensembl: ENSG00000101361
UniProt: O00567
Position
20:2652632..2658393
AA seq 594 aa
MVLLHVLFEHAVGYALLALKEVEEISLLQPQVEESVLNLGKFHSIVRLVAFCPFASSQVA
LENANAVSEGVVHEDLRLLLETHLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAE
ILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDK
DINTFSMRVREWYGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAK
AKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALI
GEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRA
AAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDV
MKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPK
KKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPK
EETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggtgctgttgcacgtgctgtttgagcacgcggtcggctacgcgctgctggcgctgaag
gaagtggaggagatcagtctgctgcagccgcaggtggaggagtctgtgctcaacctgggc
aaattccacagcatcgttcgtctggtggccttttgtccctttgcctcatcccaggttgcc
ttggaaaatgccaacgccgtgtctgaaggggttgttcatgaggacctccgcctgctcttg
gagacccacctgccgtccaaaaagaagaaagtactcttgggagttggggatcccaagatt
ggtgccgcaatacaggaggagttagggtacaactgccagactggaggagtcatagctgag
atcctgcgaggagttcgtctgcacttccacaatctggtgaagggtctgaccgatctgtca
gcttgtaaagcacagctggggctgggacacagctattcccgtgccaaagttaagtttaat
gtgaaccgggtggacaatatgatcatccagtccattagcctcctggaccagctggataag
gacatcaataccttctctatgcgtgtcagggagtggtacgggtatcactttccggagctg
gtgaagatcatcaacgacaatgccacatactgccgtcttgcccagtttattggaaaccga
agggaactgaatgaggacaagctggagaagctggaggagctgacaatggatggggccaag
gctaaggctattctggatgcctcacggtcctccatgggcatggacatatctgccattgac
ttgataaacatcgagagcttctccagtcgtgtggtgtctttatctgaataccgccagagc
ctacacacttacctgcgctccaagatgagccaagtagcccccagcctgtcagccctaatt
ggggaagcggtaggtgcacgtctcatcgcacatgctggcagcctcaccaacctggccaag
tatccagcatccacagtgcagatccttggggctgaaaaggccctgttcagagccctgaag
acaaggggtaacactccaaaatatggactcattttccactccaccttcattggccgagca
gctgccaagaacaaaggccgcatctcccgatacctggcaaacaaatgcagtattgcctca
cgaatcgattgcttctctgaggtgcccacgagtgtattcggggagaagcttcgagaacaa
gttgaagagcgactgtccttctatgagactggagagataccacgaaagaatctggatgtc
atgaaggaagcaatggttcaggcagaggaagcggctgctgagattactaggaagctggag
aaacaggagaagaaacgcttaaagaaggaaaagaaacggctggctgcacttgccctcgcg
tcttcagaaaacagcagtagtactccagaggagtgtgaggagatgagtgaaaaacccaaa
aagaagaaaaagcaaaagccccaggaggttcctcaggagaatggaatggaagacccatct
atctctttctccaaacccaagaaaaagaaatctttttccaaggaggagttgatgagtagc
gatcttgaagagaccgctggcagcaccagtattcccaagaggaagaagtctacacccaag
gaggaaacagttaatgaccctgaggaggcaggccacagaagtggctccaagaaaaagagg
aaattctccaaagaggagccggtcagcagtgggcctgaagaggcggttggcaagagcagc
tccaagaagaagaaaaagttccataaagcatcccaggaagattag

DBGET integrated database retrieval system