KEGG   Homo sapiens (human): 10533
Entry
10533             CDS       T01001                                 

Gene name
ATG7, APG7-LIKE, APG7L, GSA7
Definition
(RefSeq) autophagy related 7
  KO
K08337  ubiquitin-like modifier-activating enzyme ATG7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04216  Ferroptosis
hsa04613  Neutrophil extracellular trap formation
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10533 (ATG7)
   04136 Autophagy - other
    10533 (ATG7)
  09143 Cell growth and death
   04216 Ferroptosis
    10533 (ATG7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    10533 (ATG7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10533 (ATG7)
   04121 Ubiquitin system [BR:hsa04121]
    10533 (ATG7)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10533 (ATG7)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    10533 (ATG7)
   Atg8 conjugation proteins
    10533 (ATG7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   10533 (ATG7)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    10533 (ATG7)
SSDB
Motif
Pfam: ATG7_N ThiF Shikimate_DH GDPD_2
Other DBs
NCBI-GeneID: 10533
NCBI-ProteinID: NP_006386
OMIM: 608760
HGNC: 16935
Ensembl: ENSG00000197548
Vega: OTTHUMG00000129740
Pharos: O95352(Tbio)
UniProt: O95352 B3KQM6
Position
3p25.3
AA seq 703 aa
MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLP
ARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGT
ALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
ECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQY
PGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPK
AVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLL
LGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR
LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRES
RWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLF
ANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEG
GYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYERE
GFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggcagctacgggggatcctggactctctaaactgcagtttgccccttttagtagt
gccttggatgttgggttttggcatgagttgacccagaagaagctgaacgagtatcggctg
gatgaagctcccaaggacattaagggttattactacaatggtgactctgctgggctgcca
gctcgcttaacattggagttcagtgcttttgacatgagtgctcccaccccagcccgttgc
tgcccagctattggaacactgtataacaccaacacactcgagtctttcaagactgcagat
aagaagctccttttggaacaagcagcaaatgagatatgggaatccataaaatcaggcact
gctcttgaaaaccctgtactcctcaacaagttcctcctcttgacatttgcagatctaaag
aagtaccacttctactattggttttgctatcctgccctctgtcttccagagagtttacct
ctcattcaggggccagtgggtttggatcaaaggttttcactaaaacagattgaagcacta
gagtgtgcatatgataatctttgtcaaacagaaggagtcacagctcttccttacttctta
atcaagtatgatgagaacatggtgctggtttccttgcttaaacactacagtgatttcttc
caaggtcaaaggacgaagataacaattggtgtatatgatccctgtaacttagcccagtac
cctggatggcctttgaggaattttttggtcctagcagcccacagatggagtagcagtttc
cagtctgttgaagttgtttgcttccgtgaccgtaccatgcagggggcgagagacgttgcc
cacagcatcatcttcgaagtgaagcttccagaaatggcatttagcccagattgtcctaaa
gcagttggatgggaaaagaaccagaaaggaggcatgggaccaaggatggtgaacctcagt
gaatgtatggaccctaaaaggttagctgagtcatcagtggatctaaatctcaaactgatg
tgttggagattggttcctactttagacttggacaaggttgtgtctgtcaaatgtctgctg
cttggagccggcaccttgggttgcaatgtagctaggacgttgatgggttggggcgtgaga
cacatcacatttgtggacaatgccaagatctcctactccaatcctgtgaggcagcctctc
tatgagtttgaagattgcctagggggtggtaagcccaaggctctggcagcagcggaccgg
ctccagaaaatattccccggtgtgaatgccagaggattcaacatgagcatacctatgcct
gggcatccagtgaacttctccagtgtcactctggagcaagcccgcagagatgtggagcaa
ctggagcagctcatcgaaagccatgatgtcgtcttcctattgatggacaccagggagagc
cggtggcttcctgccgtcattgctgcaagcaagagaaagctggtcatcaatgctgctttg
ggatttgacacatttgttgtcatgagacatggtctgaagaaaccaaagcagcaaggagct
ggggacttgtgtccaaaccaccctgtggcatctgctgacctcctgggctcatcgcttttt
gccaacatccctggttacaagcttggctgctacttctgcaatgatgtggtggccccagga
gattcaaccagagaccggaccttggaccagcagtgcactgtgagtcgtccaggactggcc
gtgattgcaggagccctggccgtggaattgatggtatctgttttgcagcatccagaaggg
ggctatgccattgccagcagcagtgacgatcggatgaatgagcctccaacctctcttggg
cttgtgcctcaccagatccggggatttctttcacggtttgataatgtccttcccgtcagc
ctggcatttgacaaatgtacagcttgttcttccaaagttcttgatcaatatgaacgagaa
ggatttaacttcctagccaaggtgtttaattcttcacattccttcttagaagacttgact
ggtcttacattgctgcatcaagaaacccaagctgctgagatctgggacatgagcgatgat
gagaccatctga

DBGET integrated database retrieval system