KEGG   Homo sapiens (human): 10533
Entry
10533             CDS       T01001                                 

Gene name
ATG7, APG7-LIKE, APG7L, GSA7
Definition
(RefSeq) autophagy related 7
  KO
K08337  ubiquitin-like modifier-activating enzyme ATG7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04216  Ferroptosis
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10533 (ATG7)
   04136 Autophagy - other
    10533 (ATG7)
  09143 Cell growth and death
   04216 Ferroptosis
    10533 (ATG7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10533 (ATG7)
   04121 Ubiquitin system [BR:hsa04121]
    10533 (ATG7)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10533 (ATG7)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    10533 (ATG7)
   Atg8 conjugation proteins
    10533 (ATG7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   10533 (ATG7)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    10533 (ATG7)
SSDB
Motif
Pfam: ATG7_N ThiF Shikimate_DH GDPD_2
Other DBs
NCBI-GeneID: 10533
NCBI-ProteinID: NP_006386
OMIM: 608760
HGNC: 16935
Ensembl: ENSG00000197548
Vega: OTTHUMG00000129740
Pharos: O95352(Tbio)
UniProt: O95352 B3KQM6
Position
3p25.3
AA seq 703 aa
MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLP
ARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGT
ALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
ECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQY
PGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPK
AVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLL
LGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR
LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRES
RWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLF
ANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEG
GYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYERE
GFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggcagctacgggggatcctggactctctaaactgcagtttgccccttttagtagt
gccttggatgttgggttttggcatgagttgacccagaagaagctgaacgagtatcggctg
gatgaagctcccaaggacattaagggttattactacaatggtgactctgctgggctgcca
gctcgcttaacattggagttcagtgcttttgacatgagtgctcccaccccagcccgttgc
tgcccagctattggaacactgtataacaccaacacactcgagtctttcaagactgcagat
aagaagctccttttggaacaagcagcaaatgagatatgggaatccataaaatcaggcact
gctcttgaaaaccctgtactcctcaacaagttcctcctcttgacatttgcagatctaaag
aagtaccacttctactattggttttgctatcctgccctctgtcttccagagagtttacct
ctcattcaggggccagtgggtttggatcaaaggttttcactaaaacagattgaagcacta
gagtgtgcatatgataatctttgtcaaacagaaggagtcacagctcttccttacttctta
atcaagtatgatgagaacatggtgctggtttccttgcttaaacactacagtgatttcttc
caaggtcaaaggacgaagataacaattggtgtatatgatccctgtaacttagcccagtac
cctggatggcctttgaggaattttttggtcctagcagcccacagatggagtagcagtttc
cagtctgttgaagttgtttgcttccgtgaccgtaccatgcagggggcgagagacgttgcc
cacagcatcatcttcgaagtgaagcttccagaaatggcatttagcccagattgtcctaaa
gcagttggatgggaaaagaaccagaaaggaggcatgggaccaaggatggtgaacctcagt
gaatgtatggaccctaaaaggttagctgagtcatcagtggatctaaatctcaaactgatg
tgttggagattggttcctactttagacttggacaaggttgtgtctgtcaaatgtctgctg
cttggagccggcaccttgggttgcaatgtagctaggacgttgatgggttggggcgtgaga
cacatcacatttgtggacaatgccaagatctcctactccaatcctgtgaggcagcctctc
tatgagtttgaagattgcctagggggtggtaagcccaaggctctggcagcagcggaccgg
ctccagaaaatattccccggtgtgaatgccagaggattcaacatgagcatacctatgcct
gggcatccagtgaacttctccagtgtcactctggagcaagcccgcagagatgtggagcaa
ctggagcagctcatcgaaagccatgatgtcgtcttcctattgatggacaccagggagagc
cggtggcttcctgccgtcattgctgcaagcaagagaaagctggtcatcaatgctgctttg
ggatttgacacatttgttgtcatgagacatggtctgaagaaaccaaagcagcaaggagct
ggggacttgtgtccaaaccaccctgtggcatctgctgacctcctgggctcatcgcttttt
gccaacatccctggttacaagcttggctgctacttctgcaatgatgtggtggccccagga
gattcaaccagagaccggaccttggaccagcagtgcactgtgagtcgtccaggactggcc
gtgattgcaggagccctggccgtggaattgatggtatctgttttgcagcatccagaaggg
ggctatgccattgccagcagcagtgacgatcggatgaatgagcctccaacctctcttggg
cttgtgcctcaccagatccggggatttctttcacggtttgataatgtccttcccgtcagc
ctggcatttgacaaatgtacagcttgttcttccaaagttcttgatcaatatgaacgagaa
ggatttaacttcctagccaaggtgtttaattcttcacattccttcttagaagacttgact
ggtcttacattgctgcatcaagaaacccaagctgctgagatctgggacatgagcgatgat
gagaccatctga

KEGG   Homo sapiens (human): 64422
Entry
64422             CDS       T01001                                 

Gene name
ATG3, APG3, APG3-LIKE, APG3L, PC3-96
Definition
(RefSeq) autophagy related 3
  KO
K08343  ubiquitin-like-conjugating enzyme ATG3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
N00176  KSHV vFLIP to autophagy-vesicle elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    64422 (ATG3)
   04136 Autophagy - other
    64422 (ATG3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    64422 (ATG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64422 (ATG3)
   04121 Ubiquitin system [BR:hsa04121]
    64422 (ATG3)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    64422 (ATG3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    64422 (ATG3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   64422 (ATG3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    64422 (ATG3)
SSDB
Motif
Pfam: Autophagy_act_C Med13_N DUF5791 SDA1
Other DBs
NCBI-GeneID: 64422
NCBI-ProteinID: NP_071933
OMIM: 609606
HGNC: 20962
Ensembl: ENSG00000144848
Vega: OTTHUMG00000159260
Pharos: Q9NT62(Tbio)
UniProt: Q9NT62
Structure
PDB: 
4NAW

Position
3q13.2
AA seq 314 aa
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEE
LKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGIT
EAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVE
ACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDH
VKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAV
IPTIEYDYTRHFTM
NT seq 945 nt   +upstreamnt  +downstreamnt
atgcagaatgtgattaatactgtgaagggaaaggcactggaagtggctgagtacctgacc
ccggtcctcaaggaatcaaagtttaaggaaacaggtgtaattaccccagaagagtttgtg
gcagctggagatcacctagtccaccactgtccaacatggcaatgggctacaggggaagaa
ttgaaagtgaaggcatacctaccaacaggcaaacaatttttggtaaccaaaaatgtgccg
tgctataagcggtgcaaacagatggaatattcagatgaattggaagctatcattgaagaa
gatgatggtgatggcggatgggtagatacatatcacaacacaggtattacaggaataacg
gaagccgttaaagagatcacactggaaaataaggacaatataaggcttcaagattgctca
gcactatgtgaagaggaagaagatgaagatgaaggagaagctgcagatatggaagaatat
gaagagagtggattgttggaaacagatgaggctaccctagatacaaggaaaatagtagaa
gcttgtaaagccaaaactgatgctggcggtgaagatgctattttgcaaaccagaacttat
gacctttacatcacttatgataaatattaccagactccacgattatggttgtttggctat
gatgagcaacggcagcctttaacagttgagcacatgtatgaagacatcagtcaggatcat
gtgaagaaaacagtgaccattgaaaatcaccctcatctgccaccacctcccatgtgttca
gttcacccatgcaggcatgctgaggtgatgaagaaaatcattgagactgttgcagaagga
gggggagaacttggagttcatatgtatcttcttattttcttgaaatttgtacaagctgtc
attccaacaatagaatatgactacacaagacacttcacaatgtaa

DBGET integrated database retrieval system