KEGG   Homo sapiens (human): 10535
Entry
10535             CDS       T01001                                 

Symbol
RNASEH2A, AGS4, JUNB, RNASEHI, RNHIA, RNHL, THSD8
Name
(RefSeq) ribonuclease H2 subunit A
  KO
K10743  ribonuclease H2 subunit A [EC:3.1.26.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
Disease
H00290  Aicardi-Goutieres syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    10535 (RNASEH2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    10535 (RNASEH2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     10535 (RNASEH2A)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    10535 (RNASEH2A)
SSDB
Motif
Pfam: RNase_HII
Other DBs
NCBI-GeneID: 10535
NCBI-ProteinID: NP_006388
OMIM: 606034
HGNC: 18518
Ensembl: ENSG00000104889
Vega: OTTHUMG00000180481
Pharos: O75792(Tbio)
UniProt: O75792
Structure
PDB: 
3PUF 3P56

Position
19p13.13
AA seq 299 aa
MDLSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADL
EALKVADSKTLLESERERLFAKMEDTDFVGWALDVLSPNLISTSMLGRVKYNLNSLSHDT
ATGLIQYALDQGVNVTQVFVDTVGMPETYQARLQQSFPGIEVTVKAKADALYPVVSAASI
CAKVARDQAVKKWQFVEKLQDLDTDYGSGYPNDPKTKAWLKEHVEPVFGFPQFVRFSWRT
AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLESATSL
NT seq 900 nt   +upstreamnt  +downstreamnt
atggatctcagcgagctggagagagacaatacaggccgctgtcgcctgagttcgcctgtg
cccgcggtgtgccgcaaggagccttgcgtcctgggcgtcgatgaggcgggcaggggcccc
gtgctgggccccatggtctacgccatctgttattgtcccctgcctcgcctggcagatctg
gaggcgctgaaagtggcagactcaaagaccctattggagagcgagcgggaaaggctgttt
gcgaaaatggaggacacggactttgtcggctgggcgctggatgtgctgtctccaaacctc
atctctaccagcatgcttgggcgggtcaaatacaacctgaactccctgtcacatgataca
gccactgggcttatacagtatgcattggaccagggcgtgaacgtcacccaggtattcgtg
gacaccgtagggatgccagagacataccaggcgcggctgcagcaaagttttcccgggatt
gaggtgacggtcaaggccaaagcagatgccctctacccggtggttagtgctgccagcatc
tgtgccaaggtggcccgggaccaggccgtgaagaaatggcagttcgtggagaaactgcag
gacttggatactgattatggctcaggctaccccaatgatcccaagacaaaagcgtggttg
aaggagcacgtggagcctgtgttcggcttcccccagtttgtccggttcagctggcgcacg
gcccagaccatcctggagaaagaggcggaagatgttatatgggaggactcagcatccgag
aatcaggagggactcaggaagatcacatcctacttcctcaatgaagggtcccaagcccgt
ccccgttcttcccaccgatatttcctggaacgcggcctggagtcagcaaccagcctctag

DBGET integrated database retrieval system