KEGG   Homo sapiens (human): 10537
Entry
10537             CDS       T01001                                 

Gene name
UBD, FAT10, GABBR1, UBD-3
Definition
(RefSeq) ubiquitin D
  KO
K12157  ubiquitin D
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10537 (UBD)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   10537 (UBD)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD TBK1_ULD Ubiquitin_2
Other DBs
NCBI-GeneID: 10537
NCBI-ProteinID: NP_006389
OMIM: 606050
HGNC: 18795
Ensembl: ENSG00000213886
Vega: OTTHUMG00000031289
Pharos: O15205(Tbio)
UniProt: O15205 A0A1U9X8S6
Structure
PDB: 
6GF1 6GF2 2MBE

Position
6p22.1
AA seq 165 aa
MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPR
RSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIE
TKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG
NT seq 498 nt   +upstreamnt  +downstreamnt
atggctcccaatgcttcctgcctctgtgtgcatgtccgttccgaggaatgggatttaatg
acctttgatgccaacccatatgacagcgtgaaaaaaatcaaagaacatgtccggtctaag
accaaggttcctgtgcaggaccaggttcttttgctgggctccaagatcttaaagccacgg
agaagcctctcatcttatggcattgacaaagagaagaccatccaccttaccctgaaagtg
gtgaagcccagtgatgaggagctgcccttgtttcttgtggagtcaggtgatgaggcaaag
aggcacctcctccaggtgcgaaggtccagctcagtggcacaagtgaaagcaatgatcgag
actaagacgggtataatccctgagacccagattgtgacttgcaatggaaagagactggaa
gatgggaagatgatggcagattacggcatcagaaagggcaacttactcttcctggcatgt
tattgtattggagggtga

DBGET integrated database retrieval system