KEGG   Homo sapiens (human): 10538Help
Entry
10538             CDS       T01001                                 

Gene name
BATF, B-ATF, BATF1, SFA-2, SFA2
Definition
(RefSeq) basic leucine zipper ATF-like transcription factor
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    10538 (BATF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10538 (BATF)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    10538 (BATF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf APG6_N Phlebovirus_NSM Sec34 TMCO5 AAA_11 HALZ Atg14 DUF3450 CtIP_N Seryl_tRNA_N DUF5320
Motif
Other DBs
NCBI-GeneID: 10538
NCBI-ProteinID: NP_006390
OMIM: 612476
HGNC: 958
Ensembl: ENSG00000156127
Vega: OTTHUMG00000171486
Pharos: Q16520(Tbio)
UniProt: Q16520
Position
14q24.3
AA seq 125 aa AA seqDB search
MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSS
PRFQP
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacagctccgacagcagtgactccagcttcagccgctctcctccccctggcaaa
caggactcatctgatgatgtgagaagagttcagaggagggagaaaaatcgtattgccgcc
cagaagagccgacagaggcagacacagaaggccgacaccctgcacctggagagcgaagac
ctggagaaacagaacgcggctctacgcaaggagatcaagcagctcacagaggaactgaag
tacttcacgtcggtgctgaacagccacgagcccctgtgctcggtgctggccgccagcacg
ccctcgccccccgaggtggtgtacagcgcccacgcattccaccaacctcatgtcagctcc
ccgcgcttccagccctga

DBGET integrated database retrieval system