KEGG   Homo sapiens (human): 10539
Entry
10539             CDS       T01001                                 
Symbol
GLRX3, GLRX4, GRX3, GRX4, PICOT, TXNL2, TXNL3
Name
(RefSeq) glutaredoxin 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Glutaredoxin Thioredoxin SH3BGR Thioredoxin_2 DIM1 Phosducin HyaE Thioredoxin_8 Thioredoxin_3 GST_N_3 OST3_OST6 GREB1_C TMF_TATA_bd Thioredoxin_9 TrbC_Ftype
Other DBs
NCBI-GeneID: 10539
NCBI-ProteinID: NP_001186797
OMIM: 612754
HGNC: 15987
Ensembl: ENSG00000108010
Pharos: O76003(Tbio)
UniProt: O76003 A0A140VJK1
Structure
Position
10:130136391..130180377
AA seq 335 aa
MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKEL
PQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGS
FLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFD
IFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLK
VLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWP
TYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcggcgggggcggctgaggcagctgtagcggccgtggaggaggtcggctcagccggg
cagtttgaggagctgctgcgcctcaaagccaagtccctccttgtggtccatttctgggca
ccatgggctccacagtgtgcacagatgaacgaagttatggcagagttagctaaagaactc
cctcaagtttcatttgtgaagttggaagctgaaggtgttcctgaagtatctgaaaaatat
gaaattagctctgttcccacttttctgtttttcaagaattctcagaaaatcgaccgatta
gatggtgcacatgccccagagttgaccaaaaaagttcagcgacatgcatctagtggctcc
ttcctacccagcgctaatgaacatcttaaagaagatctcaaccttcgcttgaagaaattg
actcatgctgccccctgcatgctgtttatgaaaggaactcctcaagaaccacgctgtggt
ttcagcaagcagatggtggaaattcttcacaaacataatattcagtttagcagttttgat
atcttctcagatgaagaggttcgacagggactcaaagcctattccagttggcctacctat
cctcagctctatgtttctggagagctcataggaggacttgatataattaaggagctagaa
gcatctgaagaactagatacaatttgtcccaaagctcccaaattagaggaaaggctcaaa
gtgctgacaaataaagcttctgtgatgctctttatgaaaggaaacaaacaggaagcaaaa
tgtggattcagcaaacaaattctggaaatactaaatagtactggtgttgaatatgaaaca
ttcgatatattggaggatgaagaagttcggcaaggattaaaagcttactcaaattggcca
acataccctcagctgtatgtgaaaggggagctggtgggaggattggatattgtgaaggaa
ctgaaagaaaatggtgaattgctgcctatactgagaggagaaaattaa

DBGET integrated database retrieval system