KEGG   Homo sapiens (human): 10542
Entry
10542             CDS       T01001                                 

Gene name
LAMTOR5, HBXIP, XIP
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
  KO
K16344  ragulator complex protein LAMTOR5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    10542 (LAMTOR5)
SSDB
Motif
Pfam: LAMTOR5
Other DBs
NCBI-GeneID: 10542
NCBI-ProteinID: NP_006393
OMIM: 608521
HGNC: 17955
Ensembl: ENSG00000134248
Vega: OTTHUMG00000011568
Pharos: O43504(Tbio)
UniProt: O43504 A0A0C4DGV4
Structure
PDB: 

Position
1p13.3
AA seq 173 aa
MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVT
EACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLS
DEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
NT seq 522 nt   +upstreamnt  +downstreamnt
atggagccaggtgcaggtcacctcgacggtcaccgcgcggggagcccaagccttcgtcag
gctctgtgcgacggaagcgcagtgatgttttccagtaaagaacgcggacgttgcaccgtg
atcaattttgtccctttggaggcgccgttacggtccacgccccgctcgcgtcaagtgact
gaggcctgtggtggagaaggacgtgccgtgccgctgggttctgagccggagtggtcggtg
ggtgggatggaggcgaccttggagcagcacttggaagacacaatgaagaatccctccatt
gttggagtcctgtgcacagattcacaaggacttaatctgggttgccgcgggaccctgtca
gatgagcatgctggagtgatatctgttctagcccagcaagcagctaagctaacctctgac
cccactgatattcctgtggtgtgtctagaatcagataatgggaacattatgatccagaaa
cacgatggcatcacggtggcagtgcacaaaatggcctcttga

KEGG   Homo sapiens (human): 28956
Entry
28956             CDS       T01001                                 

Gene name
LAMTOR2, ENDAP, HSPC003, MAPBPIP, MAPKSP1AP, ROBLD3, Ragulator2, p14
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
  KO
K20398  ragulator complex protein LAMTOR2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Disease
H01218  P14 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    28956 (LAMTOR2)
SSDB
Motif
Pfam: Robl_LC7
Other DBs
NCBI-GeneID: 28956
NCBI-ProteinID: NP_054736
OMIM: 610389
HGNC: 29796
Ensembl: ENSG00000116586
Vega: OTTHUMG00000017462
Pharos: Q9Y2Q5(Tbio)
UniProt: Q9Y2Q5
Structure
PDB: 

Position
1q22
AA seq 125 aa
MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNG
NQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLT
QVAAS
NT seq 378 nt   +upstreamnt  +downstreamnt
atgctgcgccccaaggctttgacccaggtgctaagccaagccaacactggaggcgtccag
agcaccctgctgctgaataacgagggatcactgctggcctactctggttacggggacact
gacgcccgggtcaccgctgccatagccagtaacatctgggccgcctacgaccggaacggg
aaccaagcgtttaatgaagacaatctcaaattcatcctcatggactgcatggagggccgt
gtagccatcacccgagtggccaaccttctgctgtgtatgtatgccaaggagaccgtgggc
tttggaatgctcaaggccaaggcccaggctttggtgcagtacctggaggagcccctcacc
caagtggcggcatcttaa

KEGG   Homo sapiens (human): 389541
Entry
389541            CDS       T01001                                 

Gene name
LAMTOR4, C7orf59
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
  KO
K20399  ragulator complex protein LAMTOR4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    389541 (LAMTOR4)
SSDB
Other DBs
NCBI-GeneID: 389541
NCBI-ProteinID: NP_001008396
OMIM: 618834
HGNC: 33772
Ensembl: ENSG00000188186
Vega: OTTHUMG00000154854
Pharos: Q0VGL1(Tdark)
UniProt: Q0VGL1
Structure
PDB: 

Position
7q22.1
AA seq 99 aa
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMN
VPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
NT seq 300 nt   +upstreamnt  +downstreamnt
atgacttctgcgctgacccaggggctggagcgaatcccagaccagctcggctacctggta
ctgagtgaaggtgcagtgctggcgtcatctggggacctggagaatgatgagcaggcagcc
agtgccatctctgagctggtcagcacagcctgcggtttccggctgcaccgcggcatgaat
gtgcccttcaagcgcctgtctgtggtctttggagaacacacactgctggtgacggtgtca
ggacagagggtgtttgtggtgaagaggcagaaccgaggtcgggagcccattgatgtctga

KEGG   Homo sapiens (human): 55004
Entry
55004             CDS       T01001                                 

Gene name
LAMTOR1, C11orf59, PDRO, Ragulator1, p18, p27RF-Rho
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 1
  KO
K20397  ragulator complex protein LAMTOR1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    55004 (LAMTOR1)
SSDB
Motif
Pfam: LAMTOR
Other DBs
NCBI-GeneID: 55004
NCBI-ProteinID: NP_060377
OMIM: 613510
HGNC: 26068
Ensembl: ENSG00000149357
Vega: OTTHUMG00000167869
Pharos: Q6IAA8(Tbio)
UniProt: Q6IAA8
Structure
PDB: 

Position
11q13.4
AA seq 161 aa
MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAK
TASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLA
SEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP
NT seq 486 nt   +upstreamnt  +downstreamnt
atggggtgctgctacagcagcgagaacgaggactcggaccaggaccgagaggagcggaag
ctgctgctggaccctagcagcccccctaccaaagctctcaatggagccgagcccaactac
cacagcctgccttccgctcgcactgatgagcaggccctgctctcttccatccttgccaag
acagccagcaacatcattgatgtgtctgctgcagactcacagggcatggagcagcatgag
tacatggaccgtgccaggcagtacagcacccgcttggctgtgctgagcagcagcctgacc
cattggaagaagctgccaccgctgccgtctcttaccagccagccccaccaagtgctggcc
agtgagcccatcccgttctctgatttgcagcaggtctccaggatagctgcttatgcctac
agtgcactttctcagatccgtgtggacgcaaaagaggagctggttgtacagtttgggatc
ccatga

KEGG   Homo sapiens (human): 8649
Entry
8649              CDS       T01001                                 

Gene name
LAMTOR3, MAP2K1IP1, MAPBP, MAPKSP1, MP1, PRO0633, Ragulator3
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
  KO
K04370  ragulator complex protein LAMTOR3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    8649 (LAMTOR3)
   04150 mTOR signaling pathway
    8649 (LAMTOR3)
SSDB
Motif
Pfam: MAPKK1_Int
Other DBs
NCBI-GeneID: 8649
NCBI-ProteinID: NP_068805
OMIM: 603296
HGNC: 15606
Ensembl: ENSG00000109270
Vega: OTTHUMG00000131050
Pharos: Q9UHA4(Tbio)
UniProt: Q9UHA4
Structure
PDB: 

Position
4q23
AA seq 124 aa
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQG
SKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQV
VEVS
NT seq 375 nt   +upstreamnt  +downstreamnt
atggcggatgacctaaagcgattcttgtataaaaagttaccaagtgttgaagggctccat
gccattgttgtgtcagatagagatggagtacctgttattaaagtggcaaatgacaatgct
ccagagcatgctttgcgacctggtttcttatccacttttgcccttgcaacagaccaagga
agcaaacttggactttccaaaaataaaagtatcatctgttactataacacctaccaggtg
gttcaatttaatcgtttacctttggtggtgagtttcatagccagcagcagtgccaataca
ggactaattgtcagcctagaaaaggaacttgctccattgtttgaagaactgagacaagtt
gtggaagtttcttaa

DBGET integrated database retrieval system