KEGG   Homo sapiens (human): 10549Help
Entry
10549             CDS       T01001                                 

Gene name
PRDX4, AOE37-2, AOE372, HEL-S-97n, PRX-4
Definition
(RefSeq) peroxiredoxin 4
  KO
K03386  peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10549 (PRDX4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     10549 (PRDX4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   10549 (PRDX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AhpC-TSA 1-cysPrx_C Redoxin
Motif
Other DBs
NCBI-GeneID: 10549
NCBI-ProteinID: NP_006397
OMIM: 300927
HGNC: 17169
Ensembl: ENSG00000123131
Vega: OTTHUMG00000021253
Pharos: Q13162(Tbio)
UniProt: Q13162 V9HW63
Structure
PDB: 

Position
Xp22.11
AA seq 271 aa AA seqDB search
MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVY
PGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDF
TFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDL
THQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDK
HGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctgccgctgctagccgcgacaactccggaccacggccgccaccgaaggctg
cttctgctgccgctactgctgttcctgctgccggctggagctgtgcagggctgggagaca
gaggagaggccccggactcgcgaagaggagtgccacttctacgcgggtggacaagtgtac
ccgggagaggcatcccgggtatcggtcgccgaccactccctgcacctaagcaaagcgaag
atttccaagccagcgccctactgggaaggaacagctgtgatcgatggagaatttaaggag
ctgaagttaactgattatcgtgggaaatacttggttttcttcttctacccacttgatttc
acatttgtgtgtccaactgaaattatcgcttttggcgacagacttgaagaattcagatct
ataaatactgaagtggtagcatgctctgttgattcacagtttacccatttggcctggatt
aatacccctcgaagacaaggaggacttgggccaataaggattccacttctttcagatttg
acccatcagatctcaaaggactatggtgtatacctagaggactcaggccacactcttaga
ggtctcttcattattgatgacaaaggaatcctaagacaaattactctgaatgatcttcct
gtgggtagatcagtggatgagacactacgtttggttcaagcattccagtacactgacaaa
cacggagaagtctgccctgctggctggaaacctggtagtgaaacaataatcccagatcca
gctggaaagctgaagtatttcgataaactgaattga

DBGET integrated database retrieval system