KEGG   Homo sapiens (human): 10550
Entry
10550             CDS       T01001                                 
Symbol
ARL6IP5, DERP11, GTRAP3-18, HSPC127, JWA, PRAF3, Yip6b, addicsin, hp22, jmx
Name
(RefSeq) ADP ribosylation factor like GTPase 6 interacting protein 5
  KO
K20393  PRA1 family protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10550 (ARL6IP5)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    10550 (ARL6IP5)
SSDB
Motif
Pfam: PRA1 RBD-FIP Halogen_Hydrol Ac110_PIF
Other DBs
NCBI-GeneID: 10550
NCBI-ProteinID: NP_006398
OMIM: 605709
HGNC: 16937
Ensembl: ENSG00000144746
Pharos: O75915(Tbio)
UniProt: O75915 A0A024R371
Position
3:69084937..69106092
AA seq 188 aa
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF
LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM
VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT
DYISKVKE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggacgttaatatcgccccactccgcgcctgggacgatttcttcccgggttccgatcgc
tttgcccggccggacttcagggacatttccaaatggaacaaccgcgtagtgagcaacctg
ctctattaccagaccaactacctggtggtggctgccatgatgatttccattgtggggttt
ctgagtcccttcaacatgatcctgggaggaatcgtggtggtgctggtgttcacagggttt
gtgtgggcagcccacaataaagacgtccttcgccggatgaagaagcgctaccccacgacg
ttcgttatggtggtcatgttggcgagctatttccttatctccatgtttggaggagtcatg
gtctttgtgtttggcattacttttcctttgctgttgatgtttatccatgcatcgttgaga
cttcggaacctcaagaacaaactggagaataaaatggaaggaataggtttgaagaggaca
ccgatgggcattgtcctggatgccctagaacagcaggaagaaggcatcaacagactcact
gactatatcagcaaagtgaaggaataa

DBGET integrated database retrieval system