KEGG   Homo sapiens (human): 10553
Entry
10553             CDS       T01001                                 

Gene name
HTATIP2, CC3, SDR44U1, TIP30
Definition
(RefSeq) HIV-1 Tat interactive protein 2
  KO
K17290  oxidoreductase [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10553 (HTATIP2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     10553 (HTATIP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   10553 (HTATIP2)
SSDB
Motif
Pfam: NAD_binding_10 Semialdhyde_dh Sacchrp_dh_NADP Epimerase ANF_receptor DapB_N KR
Other DBs
NCBI-GeneID: 10553
NCBI-ProteinID: NP_001091991
OMIM: 605628
HGNC: 16637
Ensembl: ENSG00000109854
Vega: OTTHUMG00000166015
Pharos: Q9BUP3(Tbio)
UniProt: Q9BUP3
Structure
PDB: 
2BKA

Position
11p15.1
AA seq 242 aa
MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEE
AYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAK
AGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPG
EWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSL
KP
NT seq 729 nt   +upstreamnt  +downstreamnt
atggccgaaacagaagccctgtcgaagcttcgggaagacttcaggatgcagaataaatcc
gtctttattttgggcgccagcggagaaaccggcagagtgctcttaaaggaaatcctggag
cagggcctgttttccaaagtcacgctcattggccggaggaagctcaccttcgacgaggaa
gcttataaaaatgtgaatcaagaagtggtggactttgaaaagttggatgactacgcctct
gcctttcaaggtcatgatgttggattctgttgcctgggtaccaccagagggaaagctggg
gcggagggatttgttcgtgttgaccgagattatgtgctgaagtctgcagagctggcaaaa
gctggagggtgcaaacatttcaacttgctatcctctaaaggagctgataaatcaagcaat
tttttatatctacaagttaagggagaagtagaagccaaggttgaagaattaaaatttgat
cgttactctgtatttaggcctggagttctgttatgtgataggcaagaatctcgcccaggt
gaatggctggttagaaagttctttggctccttaccagactcttgggccagtgggcattct
gtgcctgtggtgaccgtggttagagcaatgctgaacaatgtggtgagaccaagagacaag
cagatggaactgctggagaacaaggccatccatgacctggggaaagcgcatggctctctc
aagccatga

DBGET integrated database retrieval system