KEGG   Homo sapiens (human): 10554
Entry
10554             CDS       T01001                                 

Gene name
AGPAT1, 1-AGPAT1, G15, LPAAT-alpha, LPAATA
Definition
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase 1
  KO
K13509  lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04072  Phospholipase D signaling pathway
hsa04975  Fat digestion and absorption
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    10554 (AGPAT1)
   00564 Glycerophospholipid metabolism
    10554 (AGPAT1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    10554 (AGPAT1)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    10554 (AGPAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    10554 (AGPAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     10554 (AGPAT1)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   10554 (AGPAT1)
SSDB
Motif
Pfam: Acyltransferase DUF2706
Other DBs
NCBI-GeneID: 10554
NCBI-ProteinID: NP_006402
OMIM: 603099
HGNC: 324
Ensembl: ENSG00000204310
Vega: OTTHUMG00000031210
Pharos: Q99943(Tbio)
UniProt: Q99943 A0A024RCV5
Position
6p21.32
AA seq 283 aa
MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRG
RNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGR
CVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGT
RNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTE
GLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
NT seq 852 nt   +upstreamnt  +downstreamnt
atggatttgtggccaggggcatggatgctgctgctgctgctcttcctgctgctgctcttc
ctgctgcccaccctgtggttctgcagccccagtgccaagtacttcttcaagatggccttc
tacaatggctggatcctcttcctggctgtgctcgccatccctgtgtgtgccgtgcgagga
cgcaacgtcgagaacatgaagatcttgcgtctaatgctgctccacatcaaatacctgtac
gggatccgagtggaggtgcgaggggctcaccacttccctccctcgcagccctatgttgtt
gtctccaaccaccagagctctctcgatctgcttgggatgatggaggtactgccaggccgc
tgtgtgcccattgccaagcgcgagctactgtgggctggctctgccgggctggcctgctgg
ctggcaggagtcatcttcatcgaccggaagcgcacgggggatgccatcagtgtcatgtct
gaggtcgcccagaccctgctcacccaggacgtgagggtctgggtgtttcctgagggaacg
agaaaccacaatggctccatgctgcccttcaaacgtggcgccttccatcttgcagtgcag
gcccaggttcccattgtccccatagtcatgtcctcctaccaagacttctactgcaagaag
gagcgtcgcttcacctcgggacaatgtcaggtgcgggtgctgcccccagtgcccacggaa
gggctgacaccagatgacgtcccagctctggctgacagagtccggcactccatgctcact
gttttccgggaaatctccactgatggccggggtggtggtgactatctgaagaagcctggg
ggcggtgggtga

KEGG   Homo sapiens (human): 10555
Entry
10555             CDS       T01001                                 

Gene name
AGPAT2, 1-AGPAT2, BSCL, BSCL1, LPAAB, LPAAT-beta
Definition
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase 2
  KO
K13509  lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04072  Phospholipase D signaling pathway
hsa04975  Fat digestion and absorption
Module
hsa_M00089  Triacylglycerol biosynthesis
Disease
H00419  Congenital generalized lipodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    10555 (AGPAT2)
   00564 Glycerophospholipid metabolism
    10555 (AGPAT2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    10555 (AGPAT2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    10555 (AGPAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    10555 (AGPAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     10555 (AGPAT2)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   10555 (AGPAT2)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 10555
NCBI-ProteinID: NP_006403
OMIM: 603100
HGNC: 325
Ensembl: ENSG00000169692
Vega: OTTHUMG00000020936
Pharos: O15120(Tchem)
UniProt: O15120 A0A024R8I7
Position
9q34.3
AA seq 278 aa
MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENM
SIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAK
RELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGD
LLPFKKGAFYLAVQAQVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAAD
VPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ
NT seq 837 nt   +upstreamnt  +downstreamnt
atggagctgtggccgtgtctggccgcggcgctgctgttgctgctgctgctggtgcagctg
agccgcgcggccgagttctacgccaaggtcgccctgtactgcgcgctgtgcttcacggtg
tccgccgtggcctcgctcgtctgcctgctgcgccacggcggccggacggtggagaacatg
agcatcatcggctggttcgtgcgaagcttcaagtacttttacgggctccgcttcgaggtg
cgggacccgcgcaggctgcaggaggcccgtccctgtgtcatcgtctccaaccaccagagc
atcctggacatgatgggcctcatggaggtccttccggagcgctgcgtgcagatcgccaag
cgggagctgctcttcctggggcccgtgggcctcatcatgtacctcgggggcgtcttcttc
atcaaccggcagcgctctagcactgccatgacagtgatggccgacctgggcgagcgcatg
gtcagggagaacctcaaagtgtggatctatcccgagggtactcgcaacgacaatggggac
ctgctgccttttaagaagggcgccttctacctggcagtccaggcacaggtgcccatcgtc
cccgtggtgtactcttccttctcctccttctacaacaccaagaagaagttcttcacttca
ggaacagtcacagtgcaggtgctggaagccatccccaccagcggcctcactgcggcggac
gtccctgcgctcgtggacacctgccaccgggccatgaggaccaccttcctccacatctcc
aagaccccccaggagaacggggccactgcggggtctggcgtgcagccggcccagtag

DBGET integrated database retrieval system