KEGG   Homo sapiens (human): 10558Help
Entry
10558             CDS       T01001                                 

Gene name
SPTLC1, HSAN1, HSN1, LBC1, LCB1, SPT1, SPTI
Definition
(RefSeq) serine palmitoyltransferase long chain base subunit 1
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Disease
H00265  Hereditary sensory and autonomic neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    10558 (SPTLC1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    10558 (SPTLC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    10558 (SPTLC1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     10558 (SPTLC1)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class II
   10558 (SPTLC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 10558
NCBI-ProteinID: NP_006406
OMIM: 605712
HGNC: 11277
Ensembl: ENSG00000090054
Vega: OTTHUMG00000021047
Pharos: O15269(Tchem)
UniProt: O15269 A0A024R277 Q6NUL7
Position
9q22.31
AA seq 473 aa AA seqDB search
MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEEL
IEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAA
ALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSK
RGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRR
FIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDI
DLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP
GIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCM
NRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgccacggagcagtgggttctggtggagatggtacaggcgctttacgaggct
cctgcttaccatcttattttggaagggattctgatcctctggataatcagacttcttttc
tctaagacttacaaattacaagaacgatctgatcttacagtcaaggaaaaagaagaactg
attgaagagtggcaaccagaacctcttgttcctcctgtcccaaaagaccatcctgctctc
aactacaacatcgtttcaggccctccaagccacaaaactgtggtgaatggaaaagaatgt
ataaacttcgcctcatttaattttcttggattgttggataaccctagggttaaggcagca
gctttagcatctctaaagaagtatggcgtggggacttgtggacccagaggattttatggc
acatttgatgttcatttggatttggaagaccgcctggcaaaatttatgaagacagaagaa
gccattatatactcatatggatttgccaccatagccagtgctattcctgcttactctaaa
agaggggacattgtttttgtagatagagctgcctgctttgctattcagaaaggattacag
gcatcccgtagtgacattaagttatttaagcataatgacatggctgacctcgagcgacta
ctaaaagaacaagagatcgaagatcaaaagaatcctcgcaaggctcgtgtaactcggcgt
ttcattgtagtagaaggattgtatatgaatactggaactatttgtcctcttccagaattg
gttaagttaaaatacaaatacaaagcaagaatcttcctggaggaaagcctttcatttgga
gtcctaggagagcatggccgaggagtcactgaacactatggaatcaatattgatgatatt
gatcttatcagtgccaacatggagaatgcacttgcttctattggaggtttctgctgtggc
aggtcttttgtaattgaccatcagcgactttccggccagggatactgcttttcagcttcg
ttacctcccctgttagctgctgcagcaattgaggccctcaacatcatggaagagaatcca
ggtatttttgcagtgttgaaggaaaagtgcggacaaattcataaagctttacaaggcatt
tctggattaaaagtggtgggggagtccctttctccagcctttcacctacaactggaagag
agcactgggtctcgcgagcaagatgtcagactgcttcaggaaattgtagatcaatgcatg
aacagaagtattgcattaactcaggcgcgctacttggagaaagaagagaagtgtctccct
cctcccagcattcgggttgtggtcacggtggaacaaacagaggaagaactggagagagct
gcgtccaccatcaaggaggtagcccaggccgtcctgctctag

DBGET integrated database retrieval system