KEGG   Homo sapiens (human): 10559
Entry
10559             CDS       T01001                                 

Gene name
SLC35A1, CDG2F, CMPST, CST, hCST
Definition
(RefSeq) solute carrier family 35 member A1
  KO
K15272  solute carrier family 35 (UDP-sugar transporter), member A1/2/3
Organism
hsa  Homo sapiens (human)
Network
nt06015  N-Glycan biosynthesis
  Element
N00828  Transport of CMP-N-acetylneuraminate
N00829  Mutation-inactivated SLC35A1 to transport of CMP-N-acetylneuraminate
Disease
H00119  Congenital disorders of glycosylation type II
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10559 (SLC35A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   10559 (SLC35A1)
SSDB
Motif
Pfam: Nuc_sug_transp UAA EamA
Other DBs
NCBI-GeneID: 10559
NCBI-ProteinID: NP_006407
OMIM: 605634
HGNC: 11021
Ensembl: ENSG00000164414
Vega: OTTHUMG00000015177
Pharos: P78382(Tbio)
UniProt: P78382
Position
6q15
AA seq 337 aa
MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSV
GILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVT
YQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGA
IAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFY
GYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFA
LGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggctgccccgagagacaatgtcactttattattcaagttatactgcttggcagtgatg
accctgatggctgcagtctataccatagctttaagatacacaaggacatcagacaaagaa
ctctacttttcaaccacagccgtgtgtatcacagaagttataaagttattgctaagtgtg
ggaattttagctaaagaaactggtagtctgggtagattcaaagcatctttaagagaaaat
gtcttggggagccccaaggaactgttgaagttaagtgtgccatcgttagtgtatgctgtt
cagaacaacatggctttcctagctcttagcaatctggatgcagcagtgtaccaggtgacc
taccagttgaagattccgtgtactgctttatgcactgttttaatgttaaaccggacactc
agcaaattacagtgggtttcagtttttatgctgtgtgctggagttacgcttgtacagtgg
aaaccagcccaagctacaaaagtggtggtggaacaaaatccattattagggtttggcgct
atagctattgctgtattgtgctcaggatttgcaggagtatattttgaaaaagttttaaag
agttcagatacttctctttgggtgagaaacattcaaatgtatctatcagggattattgtg
acattagctggcgtctacttgtcagatggagctgaaattaaagaaaaaggatttttctat
ggttacacatattatgtctggtttgtcatctttcttgcaagtgttggtggcctctacact
tctgttgtggttaagtacacagacaacatcatgaaaggcttttctgcagcagcggccatt
gtcctttccaccattgcttcagtaatgctgtttggattacagataacactcacctttgcc
ctgggtactcttcttgtatgtgtttccatatatctctatggattacccagacaagacact
acatccatccaacaaggagaaacagcttcaaaggagagagttattggtgtgtga

DBGET integrated database retrieval system