KEGG   Homo sapiens (human): 1056Help
Entry
1056              CDS       T01001                                 

Gene name
CEL, BAL, BSDL, BSSL, CELL, CEase, FAP, FAPP, LIPA, MODY8
Definition
(RefSeq) carboxyl ester lipase
  KO
K12298  bile salt-stimulated lipase [EC:3.1.1.3 3.1.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Disease
H00410  Maturity onset diabetes of the young (MODY)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    1056 (CEL)
   00561 Glycerolipid metabolism
    1056 (CEL)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    1056 (CEL)
   04975 Fat digestion and absorption
    1056 (CEL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1056 (CEL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     1056 (CEL)
    3.1.1.13  sterol esterase
     1056 (CEL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   1056 (CEL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Mucin-like Abhydrolase_3 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 1056
NCBI-ProteinID: NP_001798
OMIM: 114840
HGNC: 1848
Ensembl: ENSG00000170835
Vega: OTTHUMG00000020855
UniProt: B4DSX9 Q86SR3 X6R868 O75612
Structure
PDB: 

Position
9q34.13
AA seq 753 aa AA seqDB search
MGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPTK
ALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPV
MIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPG
NYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAISQS
GVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGLEYP
MLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVT
EEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIA
LAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTV
SKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLR
YWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSG
APPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVP
PTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPTGDS
GAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcctgcaactggttgtgttgggcctcacctgctgctgggcagtggcgagtgcc
gcgaagctgggcgccgtgtacacagaaggtgggttcgtggaaggcgtcaataagaagctc
ggcctcctgggtgactctgtggacatcttcaagggcatccccttcgcagctcccaccaag
gccctggaaaatcctcagccacatcctggctggcaagggaccctgaaggccaagaacttc
aagaagagatgcctgcaggccaccatcacccaggacagcacctacggggatgaagactgc
ctgtacctcaacatttgggtgccccagggcaggaagcaagtctcccgggacctgcccgtt
atgatctggatctatggaggcgccttcctcatggggtccggccatggggccaacttcctc
aacaactacctgtatgacggcgaggagatcgccacacgcggaaacgtcatcgtggtcacc
ttcaactaccgtgtcggcccccttgggttcctcagcactggggacgccaatctgccaggt
aactatggccttcgggatcagcacatggccattgcttgggtgaagaggaatatcgcggcc
ttcgggggggaccccaacaacatcacgctcttcggggagtctgctggaggtgccagcgtc
tctctgcagaccctctccccctacaacaagggcctcatccggcgagccatcagccagagc
ggcgtggccctgagtccctgggtcatccagaaaaacccactcttctgggccaaaaaggtg
gctgagaaggtgggttgccctgtgggtgatgccgccaggatggcccagtgtctgaaggtt
actgatccccgagccctgacgctggcctataaggtgccgctggcaggcctggagtacccc
atgctgcactatgtgggcttcgtccctgtcattgatggagacttcatccccgctgacccg
atcaacctgtacgccaacgccgccgacatcgactatatagcaggcaccaacaacatggac
ggccacatcttcgccagcatcgacatgcctgccatcaacaagggcaacaagaaagtcacg
gaggaggacttctacaagctggtcagtgagttcacaatcaccaaggggctcagaggcgcc
aagacgacctttgatgtctacaccgagtcctgggcccaggacccatcccaggagaataag
aagaagactgtggtggactttgagaccgatgtcctcttcctggtgcccaccgagattgcc
ctagcccagcacagagccaatgccaagagtgccaagacctacgcctacctgttttcccat
ccctctcggatgcccgtctaccccaaatgggtgggggccgaccatgcagatgacattcag
tacgttttcgggaagcccttcgccacccccacgggctaccggccccaagacaggacagtc
tctaaggccatgatcgcctactggaccaactttgccaaaacaggggaccccaacatgggc
gactcggctgtgcccacacactgggaaccctacactacggaaaacagcggctacctggag
atcaccaagaagatgggcagcagctccatgaagcggagcctgagaaccaacttcctgcgc
tactggaccctcacctatctggcgctgcccacagtgaccgaccaggaggccacccctgtg
ccccccacaggggactccgaggccactcccgtgccccccacgggtgactccgagaccgcc
cccgtgccgcccacgggtgactccggggccccccccgtgccgcccacgggtgactccggg
gccccccccgtgccgcccacgggtgactccggggccccccccgtgccgcccacgggtgac
tccggggccccccccgtgccgcccacgggtgactccggggccccccccgtgccgcccacg
ggtgactccggggccccccccgtgccgcccacgggtgactccggggccccccccgtgccg
cccacgggtgactccggcgccccccccgtgccgcccacgggtgacgccgggccccccccc
gtgccgcccacgggtgactccggcgccccccccgtgccgcccacgggtgactccggggcc
ccccccgtgacccccacgggtgactccgagaccgcccccgtgccgcccacgggtgactcc
ggggccccccctgtgccccccacgggtgactctgaggctgcccctgtgccccccacagat
gactccaaggaagctcagatgcctgcagtcattaggttttag

DBGET integrated database retrieval system