KEGG   Homo sapiens (human): 1056
Entry
1056              CDS       T01001                                 

Gene name
CEL, BAL, BSDL, BSSL, CELL, CEase, FAP, FAPP, LIPA, MODY8
Definition
(RefSeq) carboxyl ester lipase
  KO
K12298  bile salt-stimulated lipase [EC:3.1.1.3 3.1.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Disease
H00410  Maturity onset diabetes of the young (MODY)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    1056 (CEL)
   00561 Glycerolipid metabolism
    1056 (CEL)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    1056 (CEL)
   04975 Fat digestion and absorption
    1056 (CEL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1056 (CEL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     1056 (CEL)
    3.1.1.13  sterol esterase
     1056 (CEL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   1056 (CEL)
SSDB
Motif
Pfam: COesterase Mucin-like Abhydrolase_3 Say1_Mug180
Other DBs
NCBI-GeneID: 1056
NCBI-ProteinID: NP_001798
OMIM: 114840
HGNC: 1848
Ensembl: ENSG00000170835
Vega: OTTHUMG00000020855
UniProt: O75612 Q86SR3 B4DSX9 X6R868
Structure
PDB: 

Position
9q34.13
AA seq 753 aa
MGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPTK
ALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPV
MIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPG
NYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAISQS
GVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGLEYP
MLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVT
EEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIA
LAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTV
SKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLR
YWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSG
APPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVP
PTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPTGDS
GAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF
NT seq 2262 nt   +upstreamnt  +downstreamnt
atggggcgcctgcaactggttgtgttgggcctcacctgctgctgggcagtggcgagtgcc
gcgaagctgggcgccgtgtacacagaaggtgggttcgtggaaggcgtcaataagaagctc
ggcctcctgggtgactctgtggacatcttcaagggcatccccttcgcagctcccaccaag
gccctggaaaatcctcagccacatcctggctggcaagggaccctgaaggccaagaacttc
aagaagagatgcctgcaggccaccatcacccaggacagcacctacggggatgaagactgc
ctgtacctcaacatttgggtgccccagggcaggaagcaagtctcccgggacctgcccgtt
atgatctggatctatggaggcgccttcctcatggggtccggccatggggccaacttcctc
aacaactacctgtatgacggcgaggagatcgccacacgcggaaacgtcatcgtggtcacc
ttcaactaccgtgtcggcccccttgggttcctcagcactggggacgccaatctgccaggt
aactatggccttcgggatcagcacatggccattgcttgggtgaagaggaatatcgcggcc
ttcgggggggaccccaacaacatcacgctcttcggggagtctgctggaggtgccagcgtc
tctctgcagaccctctccccctacaacaagggcctcatccggcgagccatcagccagagc
ggcgtggccctgagtccctgggtcatccagaaaaacccactcttctgggccaaaaaggtg
gctgagaaggtgggttgccctgtgggtgatgccgccaggatggcccagtgtctgaaggtt
actgatccccgagccctgacgctggcctataaggtgccgctggcaggcctggagtacccc
atgctgcactatgtgggcttcgtccctgtcattgatggagacttcatccccgctgacccg
atcaacctgtacgccaacgccgccgacatcgactatatagcaggcaccaacaacatggac
ggccacatcttcgccagcatcgacatgcctgccatcaacaagggcaacaagaaagtcacg
gaggaggacttctacaagctggtcagtgagttcacaatcaccaaggggctcagaggcgcc
aagacgacctttgatgtctacaccgagtcctgggcccaggacccatcccaggagaataag
aagaagactgtggtggactttgagaccgatgtcctcttcctggtgcccaccgagattgcc
ctagcccagcacagagccaatgccaagagtgccaagacctacgcctacctgttttcccat
ccctctcggatgcccgtctaccccaaatgggtgggggccgaccatgcagatgacattcag
tacgttttcgggaagcccttcgccacccccacgggctaccggccccaagacaggacagtc
tctaaggccatgatcgcctactggaccaactttgccaaaacaggggaccccaacatgggc
gactcggctgtgcccacacactgggaaccctacactacggaaaacagcggctacctggag
atcaccaagaagatgggcagcagctccatgaagcggagcctgagaaccaacttcctgcgc
tactggaccctcacctatctggcgctgcccacagtgaccgaccaggaggccacccctgtg
ccccccacaggggactccgaggccactcccgtgccccccacgggtgactccgagaccgcc
cccgtgccgcccacgggtgactccggggccccccccgtgccgcccacgggtgactccggg
gccccccccgtgccgcccacgggtgactccggggccccccccgtgccgcccacgggtgac
tccggggccccccccgtgccgcccacgggtgactccggggccccccccgtgccgcccacg
ggtgactccggggccccccccgtgccgcccacgggtgactccggggccccccccgtgccg
cccacgggtgactccggcgccccccccgtgccgcccacgggtgacgccgggccccccccc
gtgccgcccacgggtgactccggcgccccccccgtgccgcccacgggtgactccggggcc
ccccccgtgacccccacgggtgactccgagaccgcccccgtgccgcccacgggtgactcc
ggggccccccctgtgccccccacgggtgactctgaggctgcccctgtgccccccacagat
gactccaaggaagctcagatgcctgcagtcattaggttttag

KEGG   Homo sapiens (human): 26279
Entry
26279             CDS       T01001                                 

Gene name
PLA2G2D, PLA2IID, SPLASH, sPLA2-IID, sPLA2S
Definition
(RefSeq) phospholipase A2 group IID
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    26279 (PLA2G2D)
   00565 Ether lipid metabolism
    26279 (PLA2G2D)
   00590 Arachidonic acid metabolism
    26279 (PLA2G2D)
   00591 Linoleic acid metabolism
    26279 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    26279 (PLA2G2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    26279 (PLA2G2D)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    26279 (PLA2G2D)
  09154 Digestive system
   04972 Pancreatic secretion
    26279 (PLA2G2D)
   04975 Fat digestion and absorption
    26279 (PLA2G2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    26279 (PLA2G2D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     26279 (PLA2G2D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    26279 (PLA2G2D)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N DUF5460
Other DBs
NCBI-GeneID: 26279
NCBI-ProteinID: NP_036532
OMIM: 605630
HGNC: 9033
Ensembl: ENSG00000117215
Vega: OTTHUMG00000002701
Pharos: Q9UNK4(Tchem)
UniProt: Q9UNK4
Position
1p36.12
AA seq 145 aa
MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDAT
DWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLK
RNLDTYQKRLRFYWRPHCRGQTPGC
NT seq 438 nt   +upstreamnt  +downstreamnt
atggaacttgcactgctgtgtgggctggtggtgatggctggtgtgattccaatccagggc
gggatcctgaacctgaacaagatggtcaagcaagtgactgggaaaatgcccatcctctcc
tactggccctacggctgtcactgcggactaggtggcagaggccaacccaaagatgccacg
gactggtgctgccagacccatgactgctgctatgaccacctgaagacccaggggtgcagc
atctacaaggactattacagatacaacttttcccaggggaacatccactgctctgacaag
ggaagctggtgtgagcagcagctgtgtgcctgtgacaaggaggtggccttctgcctgaag
cgcaacctggacacctaccagaagcgactgcgtttctactggcggccccactgccggggg
cagacccctgggtgctag

KEGG   Homo sapiens (human): 30814
Entry
30814             CDS       T01001                                 

Gene name
PLA2G2E, GIIE_sPLA2, sPLA2-IIE
Definition
(RefSeq) phospholipase A2 group IIE
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    30814 (PLA2G2E)
   00565 Ether lipid metabolism
    30814 (PLA2G2E)
   00590 Arachidonic acid metabolism
    30814 (PLA2G2E)
   00591 Linoleic acid metabolism
    30814 (PLA2G2E)
   00592 alpha-Linolenic acid metabolism
    30814 (PLA2G2E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    30814 (PLA2G2E)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    30814 (PLA2G2E)
  09154 Digestive system
   04972 Pancreatic secretion
    30814 (PLA2G2E)
   04975 Fat digestion and absorption
    30814 (PLA2G2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    30814 (PLA2G2E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     30814 (PLA2G2E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    30814 (PLA2G2E)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 30814
NCBI-ProteinID: NP_055404
OMIM: 618320
HGNC: 13414
Ensembl: ENSG00000188784
Vega: OTTHUMG00000002702
Pharos: Q9NZK7(Tchem)
UniProt: Q9NZK7
Structure
PDB: 

Position
1p36.13
AA seq 142 aa
MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDW
CCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNL
GTYNRKYAHYPNKLCTGPTPPC
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaaatctccccacgtgctggtgttcctttgcctcctggtggctctggtcaccgggaac
ctggttcagtttggggtgatgatcgagaagatgacaggcaagtccgccctgcagtacaac
gactatggctgttactgcggcatcggtggctcccactggccggtggaccagactgactgg
tgctgccacgcccacgactgctgctacgggcgtctggagaagctgggctgtgagcccaaa
ctggaaaagtatcttttctctgtcagcgaacgtggcattttctgcgccggcaggaccacc
tgccagcggctgacctgcgagtgtgacaagagggctgccctctgctttcgccgcaacctg
ggcacctacaaccgcaaatatgcccattatcccaacaagctgtgcaccgggcccaccccg
ccctgctga

KEGG   Homo sapiens (human): 391013
Entry
391013            CDS       T01001                                 

Gene name
PLA2G2C, UBXN10-AS1
Definition
(RefSeq) phospholipase A2 group IIC
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    391013 (PLA2G2C)
   00565 Ether lipid metabolism
    391013 (PLA2G2C)
   00590 Arachidonic acid metabolism
    391013 (PLA2G2C)
   00591 Linoleic acid metabolism
    391013 (PLA2G2C)
   00592 alpha-Linolenic acid metabolism
    391013 (PLA2G2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    391013 (PLA2G2C)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    391013 (PLA2G2C)
  09154 Digestive system
   04972 Pancreatic secretion
    391013 (PLA2G2C)
   04975 Fat digestion and absorption
    391013 (PLA2G2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    391013 (PLA2G2C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     391013 (PLA2G2C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    391013 (PLA2G2C)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 391013
NCBI-ProteinID: NP_001303651
HGNC: 9032
Ensembl: ENSG00000187980 ENSG00000225986
Vega: OTTHUMG00000002705
Position
1p36.12
AA seq 150 aa
MKVIAILTLLLFCSPTHSSFWQFQRRVKHITGRSAFFSYYGYGCYCGLGDKGIPVDDTDS
PSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTLGPGASCHCRLKACECDKQSVHCF
KESLPTYEKNFKQFSSQPRTAAPTLQKSLG
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaggtcattgccatcctcaccctcctcctcttctgctcccccacccacagcagtttc
tggcagtttcagaggagggtcaaacacatcacggggcgaagtgccttcttctcatattac
ggatatggctgctactgtgggcttggggataaagggatccccgtggatgacactgacagc
ccctcatctccctctccctacgagaagctgaaggagttcagctgccagcctgtgttgaac
agctaccagttccacatcgtcaatggcgcagtggtttgtggatgcacccttggtcctggt
gccagctgccactgcaggctgaaggcctgtgagtgtgacaagcaatccgtgcactgcttc
aaagagagcctgcccacctatgagaaaaacttcaagcagttctccagccagcccaggaca
gctgcccccaccctgcaaaaaagcctgggctag

KEGG   Homo sapiens (human): 50487
Entry
50487             CDS       T01001                                 

Gene name
PLA2G3, GIII-SPLA2, SPLA2III, sPLA2-III
Definition
(RefSeq) phospholipase A2 group III
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    50487 (PLA2G3)
   00565 Ether lipid metabolism
    50487 (PLA2G3)
   00590 Arachidonic acid metabolism
    50487 (PLA2G3)
   00591 Linoleic acid metabolism
    50487 (PLA2G3)
   00592 alpha-Linolenic acid metabolism
    50487 (PLA2G3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    50487 (PLA2G3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    50487 (PLA2G3)
  09154 Digestive system
   04972 Pancreatic secretion
    50487 (PLA2G3)
   04975 Fat digestion and absorption
    50487 (PLA2G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    50487 (PLA2G3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     50487 (PLA2G3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    50487 (PLA2G3)
SSDB
Motif
Pfam: Phospholip_A2_2 Chromadorea_ALT
Other DBs
NCBI-GeneID: 50487
NCBI-ProteinID: NP_056530
OMIM: 611651
HGNC: 17934
Ensembl: ENSG00000100078
Vega: OTTHUMG00000151255
Pharos: Q9NZ20(Tbio)
UniProt: Q9NZ20
Position
22q12.2
AA seq 509 aa
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHA
RWDAHRRLQSCSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRA
LEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLC
CREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPP
KPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWV
CRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPL
RGPMSFYNQCLQLTQAARRPDRQQKSWSQ
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggggttcaggcagggctgtttgggatgctgggcttcctgggggtggccctggggggc
tcccctgccctccgctggtacaggacctcctgccacttgaccaaggccgtccctggcaac
ccactggggtacctgagcttcctggccaaggatgctcagggactggccctgatccatgcc
cgctgggatgcgcataggaggctgcagtcatgtagctgggaggatgagccggagctcacc
gcagcctacggtgctctctgtgctcatgagactgcctggggctccttcatccacaccccc
ggacccgagctgcagagagcactggccactcttcagagtcagtgggaggcatgccgagcg
cttgaggagagtccagcaggggccaggaagaagcgagcagcagggcagagtggagtccct
ggtggagggcaccagcgagagaagagaggatggaccatgcctggcacactgtggtgtgga
gttggagattctgctgggaactcctcggagctgggggtcttccagggacctgatctctgt
tgccgggaacatgaccgctgcccacagaacatctcacccttgcagtacaactatggcatc
cgaaactaccgattccacaccatctcccactgtgactgtgacaccaggtttcagcaatgc
ctacagaatcagcacgactccatctcggacatcgtgggcgtggccttcttcaacgtgctg
gagatcccctgctttgtgctggaggagcaggaggcgtgtgtggcgtggtactggtggggc
gggtgtaggatgtacggcacagtgcccctcgctcgcctgcagcccaggaccttctacaat
gcctcctggagctcccgggccacctccccaactcccagctcccggagcccagcccctccc
aagcctcgacagaagcagcaccttcggaaggggccaccacatcagaaagggtccaagcgc
cccagcaaagccaacaccacagccctccaggaccctatggtctctcccaggcttgatgtg
gcccccacaggcctccagggcccacagggtggcctaaaacctcagggtgcccgctgggtc
tgccgcagcttccgccgccacctggaccagtgtgagcaccagattgggccccgggaaatc
gagttccagctgctcaacagcgcccaagagcccctcttccactgcaactgcacgcgccgt
ctggcacgcttcctgaggctccacagcccacccgaggttaccaacatgctttgggagctg
ctgggcacaacctgcttcaagctggcccctccactggactgtgtggaaggcaaaaactgt
tccagagaccctagggccatcagggtgtcagcccggcacttgcggaggcttcagcagagg
cgacaccagctccaggataaaggcacagatgagaggcagccatggccttcagagcccctg
agaggccccatgtcattctacaaccagtgcctgcagctaacccaggcagccaggagaccc
gacaggcagcagaagtcctggagccagtga

KEGG   Homo sapiens (human): 5319
Entry
5319              CDS       T01001                                 

Gene name
PLA2G1B, PLA2, PLA2A, PPLA2
Definition
(RefSeq) phospholipase A2 group IB
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5319 (PLA2G1B)
   00565 Ether lipid metabolism
    5319 (PLA2G1B)
   00590 Arachidonic acid metabolism
    5319 (PLA2G1B)
   00591 Linoleic acid metabolism
    5319 (PLA2G1B)
   00592 alpha-Linolenic acid metabolism
    5319 (PLA2G1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5319 (PLA2G1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5319 (PLA2G1B)
  09154 Digestive system
   04972 Pancreatic secretion
    5319 (PLA2G1B)
   04975 Fat digestion and absorption
    5319 (PLA2G1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5319 (PLA2G1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5319 (PLA2G1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    5319 (PLA2G1B)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N Phospholip_A2_2 DUF1644
Other DBs
NCBI-GeneID: 5319
NCBI-ProteinID: NP_000919
OMIM: 172410
HGNC: 9030
Ensembl: ENSG00000170890
Vega: OTTHUMG00000169343
Pharos: P04054(Tchem)
UniProt: P04054
Structure
PDB: 
3ELO

Position
12q24.31
AA seq 148 aa
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaactccttgtgctagctgtgctgctcacagtggccgccgccgacagcggcatcagc
cctcgggccgtgtggcagttccgcaaaatgatcaagtgcgtgatcccggggagtgacccc
ttcttggaatacaacaactacggctgctactgtggcttggggggctcaggcacccccgtg
gatgaactggacaagtgctgccagacacatgacaactgctatgaccaggccaagaagctg
gacagctgtaaatttctgctggacaacccgtacacccacacctattcatactcgtgctct
ggctcggcaatcacctgtagcagcaaaaacaaagagtgtgaggccttcatttgcaactgc
gaccgcaacgctgccatctgcttttcaaaagctccatataacaaggcacacaagaacctg
gacaccaagaagtattgtcagagttga

KEGG   Homo sapiens (human): 5320
Entry
5320              CDS       T01001                                 

Gene name
PLA2G2A, MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2
Definition
(RefSeq) phospholipase A2 group IIA
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5320 (PLA2G2A)
   00565 Ether lipid metabolism
    5320 (PLA2G2A)
   00590 Arachidonic acid metabolism
    5320 (PLA2G2A)
   00591 Linoleic acid metabolism
    5320 (PLA2G2A)
   00592 alpha-Linolenic acid metabolism
    5320 (PLA2G2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5320 (PLA2G2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5320 (PLA2G2A)
  09154 Digestive system
   04972 Pancreatic secretion
    5320 (PLA2G2A)
   04975 Fat digestion and absorption
    5320 (PLA2G2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5320 (PLA2G2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5320 (PLA2G2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    5320 (PLA2G2A)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 5320
NCBI-ProteinID: NP_000291
OMIM: 172411
HGNC: 9031
Ensembl: ENSG00000188257
Vega: OTTHUMG00000002699
Pharos: P14555(Tchem)
UniProt: P14555 A0A024RA96
Structure
PDB: 

Position
1p36.13
AA seq 144 aa
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaagaccctcctactgttggcagtgatcatgatctttggcctactgcaggcccatggg
aatttggtgaatttccacagaatgatcaagttgacgacaggaaaggaagccgcactcagt
tatggcttctacggctgccactgtggcgtgggtggcagaggatcccccaaggatgcaacg
gatcgctgctgtgtcactcatgactgttgctacaaacgtctggagaaacgtggatgtggc
accaaatttctgagctacaagtttagcaactcggggagcagaatcacctgtgcaaaacag
gactcctgcagaagtcaactgtgtgagtgtgataaggctgctgccacctgttttgctaga
aacaagacgacctacaataaaaagtaccagtactattccaataaacactgcagagggagc
acccctcgttgctga

KEGG   Homo sapiens (human): 5322
Entry
5322              CDS       T01001                                 

Gene name
PLA2G5, FRFB, GV-PLA2, PLA2-10, hVPLA(2)
Definition
(RefSeq) phospholipase A2 group V
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Disease
H02440  Fleck retina, familial benign
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5322 (PLA2G5)
   00565 Ether lipid metabolism
    5322 (PLA2G5)
   00590 Arachidonic acid metabolism
    5322 (PLA2G5)
   00591 Linoleic acid metabolism
    5322 (PLA2G5)
   00592 alpha-Linolenic acid metabolism
    5322 (PLA2G5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5322 (PLA2G5)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5322 (PLA2G5)
  09154 Digestive system
   04972 Pancreatic secretion
    5322 (PLA2G5)
   04975 Fat digestion and absorption
    5322 (PLA2G5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5322 (PLA2G5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5322 (PLA2G5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    5322 (PLA2G5)
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Other DBs
NCBI-GeneID: 5322
NCBI-ProteinID: NP_000920
OMIM: 601192
HGNC: 9038
Ensembl: ENSG00000127472
Vega: OTTHUMG00000002698
Pharos: P39877(Tchem)
UniProt: P39877
Position
1p36.13
AA seq 138 aa
MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGT
DWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKR
NLRSYNPQYQYFPNILCS
NT seq 417 nt   +upstreamnt  +downstreamnt
atgaaaggcctcctcccactggcttggttcctggcttgtagtgtgcctgctgtgcaagga
ggcttgctggacctaaaatcaatgatcgagaaggtgacagggaagaacgccctgacaaac
tacggcttctacggctgttactgcggctggggcggccgaggaacccccaaggatggcacc
gattggtgctgttgggcgcatgaccactgctatgggcggctggaggagaagggctgcaac
attcgcacacagtcctacaaatacagattcgcgtggggcgtggtcacctgcgagcccggg
cccttctgccatgtgaacctctgtgcctgtgaccggaagctcgtctactgcctcaagaga
aacctacggagctacaacccacagtaccaatactttcccaacatcctctgctcctag

KEGG   Homo sapiens (human): 5406
Entry
5406              CDS       T01001                                 

Gene name
PNLIP, PL, PNLIPD, PTL
Definition
(RefSeq) pancreatic lipase
  KO
K14073  pancreatic triacylglycerol lipase [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
hsa04977  Vitamin digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Disease
H02330  Pancreatic lipase deficiency
Drug target
Cetilistat: D09208<JP>
Orlistat: D04028<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    5406 (PNLIP)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5406 (PNLIP)
   04975 Fat digestion and absorption
    5406 (PNLIP)
   04977 Vitamin digestion and absorption
    5406 (PNLIP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     5406 (PNLIP)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 Hydrolase_4 Abhydrolase_1 Retrotran_gag_3
Other DBs
NCBI-GeneID: 5406
NCBI-ProteinID: NP_000927
OMIM: 246600
HGNC: 9155
Ensembl: ENSG00000175535
Vega: OTTHUMG00000019103
Pharos: P16233(Tclin)
UniProt: P16233
Structure
PDB: 
1LPB 1N8S 1LPA

Position
10q25.3
AA seq 465 aa
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC
VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgctgccactttggactctttcactgctgctgggagcagtagcaggaaaagaagtttgc
tacgaaagactcggctgcttcagtgatgactccccatggtcaggaattacggaaagaccc
ctccatatattgccttggtctccaaaagatgtcaacacccgcttcctcctatatactaat
gagaacccaaacaactttcaagaagttgccgcagattcatcaagcatcagtggctccaat
ttcaaaacaaatagaaaaactcgctttattattcatggattcatagacaagggagaagaa
aactggctggccaatgtgtgcaagaatctgttcaaggtggaaagtgtgaactgtatctgt
gtggactggaaaggtggctcccgaactggatacacacaagcctcgcagaacatcaggatc
gtgggagcagaagtggcatattttgttgaatttcttcagtcggcgttcggttactcacct
tccaatgtgcatgtcattggccacagcctgggtgcccacgctgctggggaggctggaagg
agaaccaatgggaccattggacgcatcacagggttggacccagcagaaccttgctttcag
ggcacacctgaattagtccgattggaccccagcgatgccaaatttgtggatgtaattcac
acggatggtgcccccatagtccccaatttggggtttggaatgagccaagtcgtgggccac
ctagatttctttccaaatggaggagtggaaatgcctggatgtaaaaagaacattctctct
cagattgtggacatagacggaatctgggaagggactcgagactttgcggcctgtaatcac
ttaagaagctacaaatattacactgatagcatcgtcaaccctgatggctttgctggattc
ccctgtgcctcttacaacgtcttcactgcaaacaagtgtttcccttgtccaagtggaggc
tgcccacagatgggtcactatgctgatagatatcctgggaaaacaaatgatgtgggccag
aaattttatctagacactggtgatgccagtaattttgcacgttggaggtataaggtatct
gtcacactgtctggaaaaaaggttacaggacacatactagtttctttgttcggaaataaa
ggaaactctaagcagtatgaaattttcaagggcactctcaaaccagatagtactcattcc
aatgaatttgactcagatgtggatgttggggacttgcagatggttaaatttatttggtat
aacaatgtgatcaacccaactttacctagagtgggagcatccaagattatagtggagaca
aatgttggaaaacagttcaacttctgtagtccagaaaccgtcagggaggaagttctgctc
accctcacaccgtgttag

KEGG   Homo sapiens (human): 5407
Entry
5407              CDS       T01001                                 

Gene name
PNLIPRP1, PLRP1
Definition
(RefSeq) pancreatic lipase related protein 1
  KO
K14074  pancreatic lipase-related protein 1 [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Drug target
Orlistat: D04028<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    5407 (PNLIPRP1)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5407 (PNLIPRP1)
   04975 Fat digestion and absorption
    5407 (PNLIPRP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     5407 (PNLIPRP1)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 Palm_thioest Abhydrolase_3 Abhydrolase_1 Lipase_3 LIDHydrolase DUF900 DUF676
Other DBs
NCBI-GeneID: 5407
NCBI-ProteinID: NP_001290064
OMIM: 604422
HGNC: 9156
Ensembl: ENSG00000187021
Vega: OTTHUMG00000019109
Pharos: P54315(Tbio)
UniProt: P54315
Structure
PDB: 
2PPL

Position
10q25.3
AA seq 467 aa
MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYT
NENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNC
ICVDWKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEA
GSKTPGLSRITGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMG
HLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEASNFARWRYGV
SITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTHSYEFDAKLDVGTIEKVKFLW
NNNVINPTLPKVGATKITVQKGEEKTVYNFCSEDTVREDTLLTLTPC
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgctgatcttctggacaatcacacttttcctgctgggagcagccaaaggaaaagaagtt
tgctatgaggacctcgggtgcttttctgacactgagccctggggcgggacagcaatcagg
cccctgaaaattctcccctggagccctgagaagatcggcacccgcttcctgctgtacacc
aatgaaaacccaaacaactttcaaattctcctcctctctgatccatcaacaattgaggca
tcaaattttcaaatggacagaaagacccggttcatcatccatggcttcatagacaaagga
gatgagagctgggtgacagacatgtgcaagaaactgttcgaggtggaggaggtgaactgc
atctgcgtggactggaagaagggctcccaagccacctacacacaggctgccaacaacgtg
cgagtggtgggcgcccaggtggcccagatgctcgacatcctcttgacagagtatagctac
cccccttccaaagttcacctcattggccacagcctgggagcccacgtggctggagaggca
ggaagcaagactccaggcctgagcaggattacagggttggatcctgtagaagcaagtttc
gagagtactcctgaagaggtgcgacttgatccctctgatgctgactttgttgatgtgatt
cacacggatgcagctcccctgatcccattcttgggttttggaacgaaccaacagatgggt
catcttgacttcttccccaatggaggagagagcatgccgggatgcaagaagaatgccctg
tctcagatcgtggatctagatggcatctgggcgggaacccgggactttgtggcttgcaat
cacctaagaagctacaagtattacttggaaagcatcctcaatcccgatgggtttgctgca
tatccctgcacttcctacaagtcctttgagtctgacaagtgcttcccgtgtccagatcaa
ggatgcccacagatgggtcactatgctgataaatttgctggcaggacaagtgaagagcag
cagaaattcttcttgaacacaggagaggctagcaatttcgctcgctggagatatggggtt
tccatcacactgtctggaagaacagccactggtcagatcaaagttgctttgtttggaaat
aagggaaacactcaccagtacagtatcttcagggggattctcaaaccaggctcaacccat
tcctatgagtttgatgcaaagctggatgttggaacaattgagaaagtcaagtttctttgg
aataacaatgtgataaatccaaccctccccaaagtgggtgccaccaagatcactgtgcaa
aagggagaagagaagacagtgtacaacttctgtagcgaagacacagtgcgggaagacacg
ctgctcaccctcacgccctgctaa

KEGG   Homo sapiens (human): 5408
Entry
5408              CDS       T01001                                 

Gene name
PNLIPRP2, PLRP2
Definition
(RefSeq) pancreatic lipase related protein 2 (gene/pseudogene)
  KO
K14075  pancreatic lipase-related protein 2 [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Drug target
Orlistat: D04028<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    5408 (PNLIPRP2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5408 (PNLIPRP2)
   04975 Fat digestion and absorption
    5408 (PNLIPRP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     5408 (PNLIPRP2)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 Retrotran_gag_3 Abhydrolase_3 Abhydrolase_1 Ser_hydrolase
Other DBs
NCBI-GeneID: 5408
NCBI-ProteinID: NP_005387
OMIM: 604423
HGNC: 9157
Ensembl: ENSG00000266200
Vega: OTTHUMG00000181599
Pharos: P54317(Tbio)
UniProt: P54317
Structure
PDB: 
2OXE 2PVS

Position
10q25.3
AA seq 469 aa
MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYT
NENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNC
ICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEA
GRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKV
GHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFL
GYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYK
VSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKF
LWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgctgcccccttggaccctcggccttctcctgctggccacagtcagaggaaaagaggtc
tgctacggacaacttggctgcttttctgatgaaaaaccatgggcaggaacccttcagcga
cctgtaaaattacttccctggtcccccgaggacattgacacccgctttcttctgtacaca
aatgaaaatccaaacaacttccaactaatcactggcacggaaccagacaccattgaggct
tcaaacttccaactggaccgcaagacacgcttcatcatccatggcttcttagacaaggcg
gaggacagctggccatcggacatgtgcaagaaaatgtttgaagtggagaaggtgaactgc
atctgtgtggactggaggcacgggtcccgggcaatgtacacccaagccgtgcaaaacatt
cgggttgttggggcggagacagctttcttaatacaagcactgtcgacgcagctagggtac
agccttgaggacgtgcatgtcatcggccacagcctgggcgcgcacacggccgcggaggcg
ggcaggaggctggggggccgcgtgggcaggatcacagggctggatccagcagggccgtgc
ttccaggatgaacctgaggaggttcggttggatccatctgacgccgtgtttgtggatgtg
attcacacagattcttctcccatagttccttccctaggtttcggaatgagccaaaaggtg
ggccatctggatttctttccaaatggaggaaaggaaatgcccggatgtaagaaaaatgtc
ctttcaaccattactgatattgatggaatatgggaaggaattggtggctttgtgtcttgc
aatcacctaagaagcttcgagtattactcaagcagcgtcctcaaccctgatggcttcctg
ggctatccctgtgcctcctacgatgagtttcaggagagtaagtgtttcccttgtccagct
gaaggatgccccaaaatggggcactatgctgaccaatttaaggggaaaacaagtgctgtg
gaacaaacctttttcctgaacacaggagagagtggtaactttactagttggagatataag
gtatcagtcacactttctggaaaagagaaagtgaatgggtacatcaggattgctttgtat
ggaagtaatgaaaactcaaaacaatatgagattttcaaaggatccctcaaaccagatgca
agtcacacgtgtgctattgatgtggattttaatgttggaaaaatacagaaagttaaattc
ctctggaacaaacgtgggataaatctatctgagcccaaactgggggcttcccaaatcaca
gtgcaaagtggtgaagatgggactgagtataatttttgtagcagcgacactgtggaagaa
aacgtcttgcaatctctttacccttgttaa

KEGG   Homo sapiens (human): 64600
Entry
64600             CDS       T01001                                 

Gene name
PLA2G2F, GIIFsPLA2, sPLA2-IIF
Definition
(RefSeq) phospholipase A2 group IIF
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    64600 (PLA2G2F)
   00565 Ether lipid metabolism
    64600 (PLA2G2F)
   00590 Arachidonic acid metabolism
    64600 (PLA2G2F)
   00591 Linoleic acid metabolism
    64600 (PLA2G2F)
   00592 alpha-Linolenic acid metabolism
    64600 (PLA2G2F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    64600 (PLA2G2F)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    64600 (PLA2G2F)
  09154 Digestive system
   04972 Pancreatic secretion
    64600 (PLA2G2F)
   04975 Fat digestion and absorption
    64600 (PLA2G2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    64600 (PLA2G2F)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     64600 (PLA2G2F)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    64600 (PLA2G2F)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 64600
NCBI-ProteinID: NP_073730
OMIM: 616793
HGNC: 30040
Ensembl: ENSG00000158786
Vega: OTTHUMG00000002704
Pharos: Q9BZM2(Tchem)
UniProt: Q9BZM2
Position
1p36.12
AA seq 211 aa
MADGAKANPKGFKKKVLDRCFSGWRGPRFGASCPSRTSRSSLGMKKFFTVAILAGSVLST
AHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEVDWCCHAHDCCYQELFDQ
GCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLCLMNQTYREEYRGFLNVY
CQGPTPNCSIYEPPPEEVTCSHQSPAPPAPP
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcagatggggcaaaggccaaccccaaagggttcaaaaagaaggtgctggatagatgc
ttctctgggtggaggggcccacgcttcggggcctcctgtccttcaagaacctccaggtct
agcctgggtatgaagaagttcttcaccgtggccatccttgctggcagcgttctgtccaca
gctcacggcagcctgctcaacctgaaggccatggtggaggccgtcacagggaggagcgcc
atcctgtccttcgtgggctacggttgctactgtgggctggggggccgtggccagcccaag
gatgaggtggactggtgctgccacgcccacgactgctgctaccaggaactctttgaccaa
ggctgtcacccctatgtggaccactatgatcacaccatcgagaacaacactgagatagtc
tgcagtgacctcaacaagacagagtgtgacaagcagacatgcatgtgtgacaagaacatg
gttctgtgcctcatgaaccagacgtaccgagaggagtaccgtggcttcctcaatgtctac
tgccagggccccacgcccaactgcagcatctatgaaccgccccctgaggaggtcacctgc
agtcaccaatccccagcgccccccgcccctccctag

KEGG   Homo sapiens (human): 81579
Entry
81579             CDS       T01001                                 

Gene name
PLA2G12A, GXII, PLA2G12, ROSSY
Definition
(RefSeq) phospholipase A2 group XIIA
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    81579 (PLA2G12A)
   00565 Ether lipid metabolism
    81579 (PLA2G12A)
   00590 Arachidonic acid metabolism
    81579 (PLA2G12A)
   00591 Linoleic acid metabolism
    81579 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    81579 (PLA2G12A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    81579 (PLA2G12A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    81579 (PLA2G12A)
  09154 Digestive system
   04972 Pancreatic secretion
    81579 (PLA2G12A)
   04975 Fat digestion and absorption
    81579 (PLA2G12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    81579 (PLA2G12A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     81579 (PLA2G12A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    81579 (PLA2G12A)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 81579
NCBI-ProteinID: NP_110448
OMIM: 611652
HGNC: 18554
Ensembl: ENSG00000123739
Vega: OTTHUMG00000131915
Pharos: Q9BZM1(Tbio)
UniProt: Q9BZM1 Q542Y6
Position
4q25
AA seq 189 aa
MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGED
GLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKS
KNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACR
CHYEEKTDL
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgctctcgcgccccgcgctcaccctcctgctcctcctcatggccgctgttgtc
aggtgccaggagcaggcccagaccaccgactggagagccaccctgaagaccatccggaac
ggcgttcataagatagacacgtacctgaacgccgccttggacctcctgggaggcgaggac
ggtctctgccagtataaatgcagtgacggatctaagcctttcccacgttatggttataaa
ccctccccaccgaatggatgtggctctccactgtttggtgttcatcttaacattggtatc
ccttccctgacaaagtgttgcaaccaacacgacaggtgctatgagacctgtggcaaaagc
aagaatgactgtgatgaagaattccagtattgcctctccaagatctgccgagatgtacag
aaaacactaggactaactcagcatgttcaggcatgtgaaacaacagtggagctcttgttt
gacagtgttatacatttaggttgtaaaccatatctggacagccaacgagccgcatgcagg
tgtcattatgaagaaaaaactgatctttaa

KEGG   Homo sapiens (human): 8399
Entry
8399              CDS       T01001                                 

Gene name
PLA2G10, GXPLA2, GXSPLA2, SPLA2, sPLA2-X
Definition
(RefSeq) phospholipase A2 group X
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8399 (PLA2G10)
   00565 Ether lipid metabolism
    8399 (PLA2G10)
   00590 Arachidonic acid metabolism
    8399 (PLA2G10)
   00591 Linoleic acid metabolism
    8399 (PLA2G10)
   00592 alpha-Linolenic acid metabolism
    8399 (PLA2G10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8399 (PLA2G10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8399 (PLA2G10)
  09154 Digestive system
   04972 Pancreatic secretion
    8399 (PLA2G10)
   04975 Fat digestion and absorption
    8399 (PLA2G10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8399 (PLA2G10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8399 (PLA2G10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    8399 (PLA2G10)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 8399
NCBI-ProteinID: NP_003552
OMIM: 603603
HGNC: 9029
Ensembl: ENSG00000069764
Vega: OTTHUMG00000048069
Pharos: O15496(Tchem)
UniProt: O15496
Structure
PDB: 

Position
16p13.12
AA seq 165 aa
MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPI
AYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGP
AENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
NT seq 498 nt   +upstreamnt  +downstreamnt
atggggccgctacctgtgtgcctgccaatcatgctgctcctgctactgccgtcgctgctg
ctgctgctgcttctacctggccccgggtccggcgaggcctccaggatattacgtgtgcac
cggcgtgggatcctggaactggcaggaactgtgggttgtgttggtccccgaacccccatc
gcctatatgaaatatggttgcttttgtggcttgggaggccatggccagccccgcgatgcc
attgactggtgctgccatggccacgactgttgttacactcgagctgaggaggccggctgc
agccccaagacagagcgctactcctggcagtgcgtcaatcagagcgtcctgtgcggaccg
gcagagaacaaatgccaagaactgttgtgcaagtgtgaccaggagattgctaactgctta
gcccaaactgagtacaacttaaagtacctcttctacccccagttcctatgtgagccggac
tcgcccaagtgtgactga

KEGG   Homo sapiens (human): 84647
Entry
84647             CDS       T01001                                 

Gene name
PLA2G12B, FKSG71, GXIIB, GXIIIsPLA2, PLA2G13, sPLA2-GXIIB
Definition
(RefSeq) phospholipase A2 group XIIB
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    84647 (PLA2G12B)
   00565 Ether lipid metabolism
    84647 (PLA2G12B)
   00590 Arachidonic acid metabolism
    84647 (PLA2G12B)
   00591 Linoleic acid metabolism
    84647 (PLA2G12B)
   00592 alpha-Linolenic acid metabolism
    84647 (PLA2G12B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    84647 (PLA2G12B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    84647 (PLA2G12B)
  09154 Digestive system
   04972 Pancreatic secretion
    84647 (PLA2G12B)
   04975 Fat digestion and absorption
    84647 (PLA2G12B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84647 (PLA2G12B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     84647 (PLA2G12B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    84647 (PLA2G12B)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 84647
NCBI-ProteinID: NP_115951
OMIM: 611653
HGNC: 18555
Ensembl: ENSG00000138308
Vega: OTTHUMG00000018446
Pharos: Q9BX93(Tdark)
UniProt: Q9BX93
Position
10q22.1
AA seq 195 aa
MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGK
NGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNS
QRAACICAEEEKEEL
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctggccagtggcttcttggttttgtggctcagccttgggggtggcctggctcag
agcgacacgagccctgacacggaggagtcctattcagactggggccttcggcacctccgg
ggaagctttgaatccgtcaatagctacttcgattcttttctggagctgctgggagggaag
aatggagtctgtcagtacaggtgccgatatggaaaggcaccaatgcccagacctggctac
aagccccaagagcccaatggctgcggctcctatttcctgggtctcaaggtaccagaaagt
atggacttgggcattccagcaatgacaaagtgctgcaaccagctggatgtctgttatgac
acttgcggtgccaacaaatatcgctgtgatgcaaaattccgatggtgtctccactcgatc
tgctctgaccttaagcggagtctgggctttgtctccaaagtggaagcagcctgtgattcc
ctggttgacactgtgttcaacaccgtgtggaccttgggctgccgcccctttatgaatagt
cagcgggcagcttgcatctgtgcagaggaggagaaggaagagttatga

KEGG   Homo sapiens (human): 8513
Entry
8513              CDS       T01001                                 

Gene name
LIPF, GL, HGL, HLAL
Definition
(RefSeq) lipase F, gastric type
  KO
K14452  gastric triacylglycerol lipase [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Drug target
Orlistat: D04028<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8513 (LIPF)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    8513 (LIPF)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     8513 (LIPF)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydro_lipase Hydrolase_4 Abhydrolase_6 Esterase
Other DBs
NCBI-GeneID: 8513
NCBI-ProteinID: NP_004181
OMIM: 601980
HGNC: 6622
Ensembl: ENSG00000182333
Vega: OTTHUMG00000018695
Pharos: P07098(Tclin)
UniProt: P07098
Structure
PDB: 
1HLG

Position
10q23.31
AA seq 398 aa
MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILE
VNRIPYGKKNSGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRG
NTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFI
AFSTNPSLAKRIKTFYALAPVATVKYTKSLINKLRFVPQSLFKFIFGDKIFYPHNFFDQF
LATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLSHNPAGTSVQNMFHWTQAVKS
GKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPN
LIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtggctgcttttaacaatggcaagtttgatatctgtactggggactacacatggtttg
tttggaaaattacatcctggaagccctgaagtgactatgaacattagtcagatgattact
tattggggatacccaaatgaagaatatgaagttgtgactgaagatggttatattcttgaa
gtcaatagaattccttatgggaagaaaaattcagggaatacaggccagagacctgttgtg
tttttgcagcatggtttgcttgcatcagccacaaactggatttccaacctgccgaacaac
agccttgccttcattctggcagatgctggttatgatgtgtggctgggcaacagcagagga
aacacctgggccagaagaaacttgtactattcaccagattcagttgaattctgggctttc
agctttgatgaaatggctaaatatgaccttccagccacaatcgacttcattgtaaagaaa
actggacagaagcagctacactatgttggccattcccagggcaccaccattggttttatt
gccttttccaccaatcccagcctggctaaaagaatcaaaaccttctatgctctagctcct
gttgccactgtgaagtatacaaaaagccttataaacaaacttagatttgttcctcaatcc
ctcttcaagtttatatttggtgacaaaatattctacccacacaacttctttgatcaattt
cttgctactgaagtgtgctcccgtgagatgctgaatctcctttgcagcaatgccttattt
ataatttgtggatttgacagtaagaactttaacacgagtcgcttggatgtgtatctatca
cataatccagcaggaacttctgttcaaaacatgttccattggacccaggctgttaagtct
gggaaattccaagcttatgactggggaagcccagttcagaataggatgcactatgatcag
tcccaacctccctactacaatgtgacagccatgaatgtaccaattgcagtgtggaacggt
ggcaaggacctgttggctgacccccaagatgttggccttttgcttccaaaactccccaat
cttatttaccacaaggagattcctttttacaatcacttggactttatctgggcaatggat
gcccctcaagaagtttacaatgacattgtttctatgatatcagaagataaaaagtag

DBGET integrated database retrieval system