KEGG   Homo sapiens (human): 10562Help
Entry
10562             CDS       T01001                                 

Gene name
OLFM4, GC1, GW112, OLM4, OlfD, UNQ362, bA209J19.1, hGC-1, hOLfD
Definition
(RefSeq) olfactomedin 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: OLF DUF1373 FPP zf-C4H2
Motif
Other DBs
NCBI-GeneID: 10562
NCBI-ProteinID: NP_006409
OMIM: 614061
HGNC: 17190
Ensembl: ENSG00000102837
Vega: OTTHUMG00000016981
Pharos: Q6UX06(Tbio)
UniProt: Q6UX06 A0A024QZ95
Position
13q14.3
AA seq 510 aa AA seqDB search
MRPGLSFLLALLFFLGQAAGDLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSL
GSGGSVSQLFSNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKV
REYVQLISVYEKKLLNLTVRIDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKESFGGS
SEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPP
PTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSPQHPNKGLYWVAPLNTDGRLL
EYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAV
TQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNT
WYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGKLDIVMHKMQEKVQS
INYNPFDQKLYVYNDGYLLNYDLSVLQKPQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccggcctctcatttctcctagcccttctgttcttccttggccaagctgcaggg
gatttgggggatgtgggacctccaattcccagccccggcttcagctctttcccaggtgtt
gactccagctccagcttcagctccagctccaggtcgggctccagctccagccgcagctta
ggcagcggaggttctgtgtcccagttgttttccaatttcaccggctccgtggatgaccgt
gggacctgccagtgctctgtttccctgccagacaccacctttcccgtggacagagtggaa
cgcttggaattcacagctcatgttctttctcagaagtttgagaaagaactttccaaagtg
agggaatatgtccaattaattagtgtgtatgaaaagaaactgttaaacctaactgtccga
attgacatcatggagaaggataccatttcttacactgaactggacttcgagctgatcaag
gtagaagtgaaggagatggaaaaactggtcatacagctgaaggagagttttggtggaagc
tcagaaattgttgaccagctggaggtggagataagaaatatgactctcttggtagagaag
cttgagacactagacaaaaacaatgtccttgccattcgccgagaaatcgtggctctgaag
accaagctgaaagagtgtgaggcctctaaagatcaaaacacccctgtcgtccaccctcct
cccactccagggagctgtggtcatggtggtgtggtgaacatcagcaaaccgtctgtggtt
cagctcaactggagagggttttcttatctatatggtgcttggggtagggattactctccc
cagcatccaaacaaaggactgtattgggtggcgccattgaatacagatgggagactgttg
gagtattatagactgtacaacacactggatgatttgctattgtatataaatgctcgagag
ttgcggatcacctatggccaaggtagtggtacagcagtttacaacaacaacatgtacgtc
aacatgtacaacaccgggaatattgccagagttaacctgaccaccaacacgattgctgtg
actcaaactctccctaatgctgcctataataaccgcttttcatatgctaatgttgcttgg
caagatattgactttgctgtggatgagaatggattgtgggttatttattcaactgaagcc
agcactggtaacatggtgattagtaaactcaatgacaccacacttcaggtgctaaacact
tggtataccaagcagtataaaccatctgcttctaacgccttcatggtatgtggggttctg
tatgccacccgtactatgaacaccagaacagaagagattttttactattatgacacaaac
acagggaaagagggcaaactagacattgtaatgcataagatgcaggaaaaagtgcagagc
attaactataacccttttgaccagaaactttatgtctataacgatggttaccttctgaat
tatgatctttctgtcttgcagaagccccagtaa

DBGET integrated database retrieval system