KEGG   Homo sapiens (human): 10563Help
Entry
10563             CDS       T01001                                 

Gene name
CXCL13, ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13
Definition
(RefSeq) C-X-C motif chemokine ligand 13
  KO
K10032  C-X-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10563 (CXCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10563 (CXCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10563 (CXCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10563 (CXCL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10563 (CXCL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 10563
NCBI-ProteinID: NP_006410
OMIM: 605149
HGNC: 10639
Ensembl: ENSG00000156234
Vega: OTTHUMG00000130201
Pharos: O43927(Tbio)
UniProt: O43927 Q53X90
Structure
PDB: 

Position
4q21.1
AA seq 109 aa AA seqDB search
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcatctcgacatctctgcttctcatgctgctggtcagcagcctctctccagtc
caaggtgttctggaggtctattacacaagcttgaggtgtagatgtgtccaagagagctca
gtctttatccctagacgcttcattgatcgaattcaaatcttgccccgtgggaatggttgt
ccaagaaaagaaatcatagtctggaagaagaacaagtcaattgtgtgtgtggaccctcaa
gctgaatggatacaaagaatgatggaagtattgagaaaaagaagttcttcaactctacca
gttccagtgtttaagagaaagattccctga

DBGET integrated database retrieval system