KEGG   Homo sapiens (human): 10563Help
Entry
10563             CDS       T01001                                 

Gene name
CXCL13, ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13
Definition
(RefSeq) C-X-C motif chemokine ligand 13
  KO
K10032  C-X-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10563 (CXCL13)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    10563 (CXCL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   10563 (CXCL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 10563
NCBI-ProteinID: NP_006410
OMIM: 605149
HGNC: 10639
Ensembl: ENSG00000156234
Vega: OTTHUMG00000130201
Pharos: O43927(Tbio)
UniProt: O43927 Q53X90
Structure
PDB: 

Position
4q21.1
AA seq 109 aa AA seqDB search
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcatctcgacatctctgcttctcatgctgctggtcagcagcctctctccagtc
caaggtgttctggaggtctattacacaagcttgaggtgtagatgtgtccaagagagctca
gtctttatccctagacgcttcattgatcgaattcaaatcttgccccgtgggaatggttgt
ccaagaaaagaaatcatagtctggaagaagaacaagtcaattgtgtgtgtggaccctcaa
gctgaatggatacaaagaatgatggaagtattgagaaaaagaagttcttcaactctacca
gttccagtgtttaagagaaagattccctga

DBGET integrated database retrieval system