KEGG   Homo sapiens (human): 10570Help
Entry
10570             CDS       T01001                                 

Gene name
DPYSL4, CRMP3, DRP-4, ULIP4
Definition
(RefSeq) dihydropyrimidinase like 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 10570
NCBI-ProteinID: NP_006417
OMIM: 608407
HGNC: 3016
Ensembl: ENSG00000151640
Vega: OTTHUMG00000019283
Pharos: O14531(Tbio)
UniProt: O14531
Structure
PDB: 

Position
10q26.3
AA seq 572 aa AA seqDB search
MSFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDA
HGLMVLPGGVDVHTRLQMPVLGMTPADDFCQGTKAALAGGTTMILDHVFPDTGVSLLAAY
EQWRERADSAACCDYSLHVDITRWHESIKEELEALVKEKGVNSFLVFMAYKDRCQCSDSQ
MYEIFSIIRDLGALAQVHAENGDIVEEEQKRLLELGITGPEGHVLSHPEEVEAEAVYRAV
TIAKQANCPLYVTKVMSKGAADAIAQAKRRGVVVFGEPITASLGTDGSHYWSKNWAKAAA
FVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEE
RMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKII
SAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYK
RIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFS
LSGSQADDHIARRTAQKIMAPPGGRSNITSLS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtccttccagggcaagaaaagcatcccccggatcacgagtgaccgccttctgatcaga
ggtgggaggatcgtgaatgacgaccagtccttttacgctgatgtgcacgtggaagatggc
ttgataaaacaaatcggagaaaacctcatcgtccctgggggcatcaagaccattgacgcc
cacggcctgatggtccttcctggtggcgttgacgtccacacaaggctgcagatgcctgtc
ctgggcatgacaccggctgacgacttctgtcagggcaccaaggcagcgctagcaggagga
accaccatgatcttggaccacgtcttccccgacacgggtgtgagcctgctggcggcctac
gagcagtggcgggagcgggcggacagcgcggcctgctgcgactactccctgcacgtggac
atcacccgatggcatgagagcatcaaggaggagctggaggccctggtcaaggagaagggt
gtgaactccttcctggtcttcatggcatacaaggaccggtgccagtgcagcgacagccag
atgtacgagatcttcagcatcatccgggacctgggggccttggcccaggtgcacgctgag
aacggggacatcgtggaggaggagcagaagcggttgctggagctcggcatcactggcccc
gagggccacgtgctcagccaccccgaggaggtggaggctgaggcggtgtaccgagctgtc
accatcgccaagcaggcaaactgcccgctgtacgtcaccaaggtgatgagcaagggggcg
gccgacgccatcgctcaggccaagcgcagaggggtggtcgtgtttggggagcccatcacc
gccagcctgggcaccgacggttcacactactggagcaagaactgggccaaggccgcagcc
ttcgtcacatcaccccctgtcaacccagaccccaccacggcggaccacctcacctgcttg
ctgtccagcggggacctccaggtgacaggcagcgcccactgcaccttcaccactgcccag
aaggctgtgggcaaggacaacttcgcgctgatccccgagggcaccaacggcattgaggag
cgcatgtcgatggtctgggagaaatgtgtggcctctgggaagatggacgagaatgagttc
gtcgcggtgaccagtacaaatgctgccaaaatcttcaatttttacccaaggaaggggcga
gtggctgtgggctctgacgctgacctggtcatatggaaccccaaggccaccaagatcatc
tctgccaagacccacaatctgaacgtggagtacaacatcttcgagggagtggagtgccgg
ggagcgcctgccgtggtcataagtcagggccgagtggcgctggaggacgggaagatgttt
gtcaccccgggggcgggccgcttcgtccctcggaaaacattcccggactttgtctacaag
aggatcaaagctcgcaacaggctggcggagatccacggtgtgccccgtggactgtatgac
gggcccgtccacgaggtgatggtgcctgccaagccagggagtggcgctccggcccgcgcg
tcctgcccaggcaagatctccgtccctcctgtgcgcaacctacatcagtcggggttcagc
ctatctgggtctcaggctgatgaccacatcgcccgacgcacagcacagaagatcatggca
ccacctggcggccgctccaacatcacctctctctcctag

DBGET integrated database retrieval system