KEGG   Homo sapiens (human): 10572
Entry
10572             CDS       T01001                                 

Gene name
SIVA1, CD27BP, SIVA, Siva-1, Siva-2
Definition
(RefSeq) SIVA1 apoptosis inducing factor
  KO
K22744  apoptosis regulatory protein Siva
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    10572 (SIVA1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 10572
NCBI-ProteinID: NP_006418
OMIM: 605567
HGNC: 17712
Ensembl: ENSG00000184990
Vega: OTTHUMG00000170819
Pharos: O15304(Tbio)
UniProt: O15304
Position
14q32.33
AA seq 175 aa
MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDE
GCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRA
VDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
NT seq 528 nt   +upstreamnt  +downstreamnt
atgcccaagcggagctgccccttcgcggacgtggccccgctacagctcaaggtccgcgtg
agccagagggagttgagccgcggcgtgtgcgccgagcgctactcgcaggaggtcttcgag
aagaccaagcgactcctgttcctcggggcccaggcctacctggaccacgtgtgggatgaa
ggctgtgccgtcgttcacctgccagagtccccaaagcctggccctacaggggccccgagg
gctgcacgtgggcagatgctgattggaccagacggccgcctgatcaggagccttgggcag
gcctccgaagctgacccatctggggtagcgtccattgcctgttcctcatgcgtgcgagcc
gtggatgggaaggcggtctgcggtcagtgtgagcgagccctgtgcgggcagtgtgtgcgc
acctgctggggctgcggctccgtggcctgtaccctgtgtggcctcgtggactgcagtgac
atgtacgagaaagtgctgtgcaccagctgtgccatgttcgagacctga

DBGET integrated database retrieval system