KEGG   Homo sapiens (human): 10574
Entry
10574             CDS       T01001                                 
Symbol
CCT7, CCTETA, CCTH, NIP7-1, TCP1ETA
Name
(RefSeq) chaperonin containing TCP1 subunit 7
  KO
K09499  T-complex protein 1 subunit eta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10574 (CCT7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10574 (CCT7)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   10574 (CCT7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10574 (CCT7)
  Exosomal proteins of colorectal cancer cells
   10574 (CCT7)
  Exosomal proteins of bladder cancer cells
   10574 (CCT7)
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 10574
NCBI-ProteinID: NP_006420
OMIM: 605140
HGNC: 1622
Ensembl: ENSG00000135624
Pharos: Q99832(Tbio)
UniProt: Q99832
Structure
Position
2:73234308..73253005
AA seq 543 aa
MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISN
DGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQI
IIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVV
DAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALL
NVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVAT
QYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNF
FTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYL
RDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDIN
NEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRG
RPH
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgatgcccacaccagttatcctattgaaagaggggactgatagctcccaaggcatcccc
cagcttgtgagtaacatcagtgcctgccaggtgattgctgaggctgtaagaactaccctg
ggtccccgtggcatggacaagcttattgtagatggcagaggcaaagcaacaatttctaat
gatggggccacaattctgaaacttcttgatgttgtccatcctgcagcaaagactttggta
gacattgccaaatcccaagatgctgaggtgggtgatggcaccacctcagtgaccttgctg
gctgcagagtttctgaagcaggtgaaaccctatgtggaggaaggtttacacccccagatc
atcattcgagctttccgcacagccacccagctggcagttaacaagatcaaagagattgct
gtgaccgtgaagaaggcagataaagtggagcagaggaagctgctggaaaagtgtgccatg
accgctctgagctccaagctgatctcccagcagaaagctttctttgctaagatggtggtg
gatgcagtgatgatgctcgatgatttgctgcagcttaaaatgattggaatcaagaaggta
cagggtggagccctcgaggattctcagctggtagctggtgttgcattcaagaagactttc
tcttacgctgggtttgaaatgcaacccaaaaagtaccacaatcccaagattgcccttttg
aatgtcgagctcgagttgaaagctgagaaagacaatgctgagataagagtccacacagtt
gaggattatcaggcaattgttgatgctgagtggaacattctctatgacaagttagagaag
atccatcattctggagccaaagttgtcttgtccaaactccccattggggatgtggccacc
cagtactttgctgacagggacatgttctgtgctggccgagtacctgaggaggatctgaag
aggacaatgatggcctgtggaggctcaatccagaccagtgtgaatgctctgtcagcagat
gtgctgggtcgatgccaggtgtttgaagagacccagattggaggcgagaggtacaatttt
tttactggctgccccaaggccaagacatgcaccttcattctccgtggcggcgccgagcag
tttatggaggagacagagcggtccctgcatgatgccatcatgatcgtcaggagggccatc
aagaatgattcagtggtggctggtggcggggccattgagatggaactctccaagtacctg
cgggattactcaaggactattccaggaaaacagcagctgttgattggggcatatgccaag
gccttggagattatcccacgccagctgtgtgacaatgctggctttgatgccacaaacatt
ctcaacaagctgcgggctcggcatgcccaggggggtacatggtatggagtagacatcaac
aacgaggacattgctgacaactttgaagctttcgtgtgggagccagctatggtgcggatc
aatgcgctgacagcagcctctgaggctgcgtgcctgatcgtgtctgtagatgaaaccatc
aagaacccccgctcgactgtggatgctcccacagcagcaggccggggccgtggtcgtggc
cgcccccactga

DBGET integrated database retrieval system