KEGG   Homo sapiens (human): 10576
Entry
10576             CDS       T01001                                 

Gene name
CCT2, 99D8.1, CCT-beta, CCTB, HEL-S-100n, PRO1633, TCP-1-beta
Definition
(RefSeq) chaperonin containing TCP1 subunit 2
  KO
K09494  T-complex protein 1 subunit beta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10576 (CCT2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10576 (CCT2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10576 (CCT2)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   10576 (CCT2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    10576 (CCT2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10576 (CCT2)
  Exosomal proteins of colorectal cancer cells
   10576 (CCT2)
  Exosomal proteins of bladder cancer cells
   10576 (CCT2)
SSDB
Motif
Pfam: Cpn60_TCP1 DUF2529 Ribosomal_S13
Other DBs
NCBI-GeneID: 10576
NCBI-ProteinID: NP_006422
OMIM: 605139
HGNC: 1615
Ensembl: ENSG00000166226
Vega: OTTHUMG00000169383
Pharos: P78371(Tbio)
UniProt: P78371 V9HW96
Structure
PDB: 

Position
12q15
AA seq 535 aa
MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAS
LMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKK
IHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFT
KLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIA
NTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYP
EQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLI
HFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHA
VTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDM
REGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggcgtccctttcccttgcacctgttaacatctttaaggcaggagctgatgaagagaga
gcagagacagctcgtctgacttcttttattggtgccatcgccattggagacttggtaaag
agcaccttgggacccaaaggcatggacaaaattcttctaagcagtggacgagatgcctct
cttatggtaaccaatgatggtgccactattctaaaaaacattggtgttgacaatccagca
gctaaagttttagttgatatgtcaagggttcaagatgatgaagttggtgatggcactacc
tctgttaccgttttagcagcagaattattaagggaagcagaatctttaattgcaaaaaag
attcatccacagaccatcatagcgggttggagagaagccacgaaggctgcaagagaggcg
ctgttgagttctgcagttgatcatggttccgatgaagttaaattccgtcaagatttaatg
aatattgcgggcacaacattatcctcaaaacttcttactcatcacaaagaccactttaca
aagttagctgtagaagcagttctcagactgaaaggctctggcaacctggaggcaattcat
attatcaagaagctaggaggaagtttggcagattcctatttagatgaaggcttcctgttg
gataaaaaaattggagtaaatcaaccaaaacgaattgaaaatgctaaaattcttattgca
aatactggtatggatacagacaaaataaagatatttggttcccgggtaagagttgactct
acagcaaaggttgcagaaatagaacatgcggaaaaggaaaaaatgaaggagaaagttgaa
cgtattcttaagcatggaataaattgctttattaacaggcaattaatttataattatcct
gaacagctctttggtgctgctggtgtcatggctattgagcatgcagattttgcaggtgtg
gaacgcctagctcttgtcacaggtggtgaaattgcctctacctttgatcacccagaactg
gtgaagcttggaagttgcaaacttatcgaggaagtcatgattggagaagacaaactcatt
cacttttctggggttgcccttggtgaggcttgtaccattgttttgcgtggtgccactcaa
caaattttagatgaagcagaaagatcattgcatgatgctctttgtgttcttgcgcaaact
gtaaaggactctagaacagtttatggaggaggctgttctgagatgttgatggctcatgct
gtgacacagcttgccaatagaacaccaggcaaagaagctgttgcaatggagtcttatgct
aaagcactgagaatgttgccaaccatcatagctgacaatgcaggctatgacagtgcagac
ctggtggcacagctcagggctgctcacagtgaaggcaataccactgctggattggatatg
agggaaggcaccattggagatatggctatcctgggtataacagaaagttttcaagtgaag
cgacaggttcttctgagtgcagctgaagcagcagaggtgattctgcgtgtggacaacatc
atcaaagcggcacccaggaaacgtgtccctgatcaccacccctgttaa

DBGET integrated database retrieval system