KEGG   Homo sapiens (human): 10578
Entry
10578             CDS       T01001                                 

Gene name
GNLY, D2S69E, LAG-2, LAG2, NKG5, TLA519
Definition
(RefSeq) granulysin
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SapB_2
Other DBs
NCBI-GeneID: 10578
NCBI-ProteinID: NP_006424
OMIM: 188855
HGNC: 4414
Ensembl: ENSG00000115523
Vega: OTTHUMG00000130179
Pharos: P22749(Tbio)
UniProt: P22749
Structure
PDB: 
1L9L

Position
2p11.2
AA seq 145 aa
MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQ
ELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQ
GLVAGETAQQICEDLRLCIPSTGPL
NT seq 438 nt   +upstreamnt  +downstreamnt
atggctacctgggccctcctgctccttgcagccatgctcctgggcaacccaggtctggtc
ttctctcgtctgagccctgagtactacgacctggcaagagcccacctgcgtgatgaggag
aaatcctgcccgtgcctggcccaggagggcccccagggtgacctgttgaccaaaacacag
gagctgggccgtgactacaggacctgtctgacgatagtccaaaaactgaagaagatggtg
gataagcccacccagagaagtgtttccaatgctgcgacccgggtgtgtaggacggggagg
tcacgatggcgcgacgtctgcagaaatttcatgaggaggtatcagtctagagttacccag
ggcctcgtggccggagaaactgcccagcagatctgtgaggacctcaggttgtgtatacct
tctacaggtcccctctga

DBGET integrated database retrieval system