KEGG   Homo sapiens (human): 10579
Entry
10579             CDS       T01001                                 

Gene name
TACC2, AZU-1, ECTACC
Definition
(RefSeq) transforming acidic coiled-coil containing protein 2
  KO
K14282  transforming acidic coiled-coil-containing protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10579 (TACC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   TACC proteins
    10579 (TACC2)
SSDB
Motif
Pfam: TACC_C Skp1_POZ
Other DBs
NCBI-GeneID: 10579
NCBI-ProteinID: NP_996744
OMIM: 605302
HGNC: 11523
Ensembl: ENSG00000138162
Vega: OTTHUMG00000019181
Pharos: O95359(Tbio)
UniProt: O95359
Position
10q26.13
AA seq 2948 aa
MGNENSTSDNQRTLSAQTPRSAQPPGNSQNIKRKQQDTPGSPDHRDASSIGSVGLGGFCT
ASESSASLDPCLVSPEVTEPRKDPQGARGPEGSLLPSPPPSQEREHPSSSMPFAECPPEG
CLASPAAAPEDGPQTQSPRREPAPNAPGDIAAAFPAERDSSTPYQEIAAVPSAGRERQPK
EEGQKSSFSFSSGIDQSPGMSPVPLREPMKAPLCGEGDQPGGFESQEKEAAGGFPPAESR
QGVASVQVTPEAPAAAQQGTESSAVLEKSPLKPMAPIPQDPAPRASDRERGQGEAPPQYL
TDDLEFLRACHLPRSNSGAAPEAEVNAASQESCQQPVGAYLPHAELPWGLPSPALVPEAG
GSGKEALDTIDVQGHPQTGMRGTKPNQVVCVAAGGQPEGGLPVSPEPSLLTPTEEAHPAS
SLASFPAAQIPIAVEEPGSSSRESVSKAGMPVSADAAKEVVDAGLVGLERQVSDLGSKGE
HPEGDPGEVPAPSPQERGEHLNTEQSHEVQPGVPPPPLPKEQSHEVQPGAPPPPLPKAPS
ESARGPPGPTDGAKVHEDSTSPAVAKEGSRSPGDSPGGKEEAPEPPDGGDPGNLQGEDSQ
AFSSKRDPEVGKDELSKPSSDAESRDHPSSHSAQPPRKGGAGHTDGPHSQTAEADASGLP
HKLGEEDPVLPPVPDGAGEPTVPEGAIWEGSGLQPKCPDTLQSREGLGRMESFLTLESEK
SDFPPTPVAEVAPKAQEGESTLEIRKMGSCDGEGLLTSPDQPRGPACDASRQEFHAGVPH
PPQGENLAADLGLTALILDQDQQGIPSCPGEGWIRGAASEWPLLSSEKHLQPSQAQPETS
IFDVLKEQAQPPENGKETSPSHPGFKDQGADSSQIHVPVEPQEDNNLPTHGGQEQALGSE
LQSQLPKGTLSDTPTSSPTDMVWESSLTEESELSAPTRQKLPALGEKRPEGACGDGQSSR
VSPPAADVLKDFSLAGNFSRKETCCTGQGPNKSQQALADALEEGSQHEEACQRHPGASEA
ADGCSPLWGLSKREMASGNTGEAPPCQPDSVALLDAVPCLPALAPASPGVTPTQDAPETE
ACDETQEGRQQPVPAPQQKMECWATSDAESPKLLASFPSAGEQGGEAGAAETGGSAGAGD
PGKQQAPEKPGEATLSCGLLQTEHCLTSGEEASTSALRESCQAEHPMASCQDALLPAREL
GGIPRSTMDFSTHQAVPDPKELLLSGPPEVAAPDTPYLHVDSAAQRGAEDSGVKAVSSAD
PRAPGESPCPVGEPPLALENAASLKLFAGSLAPLLQPGAAGGEIPAVQASSGSPKARTTE
GPVDSMPCLDRMPLLAKGKQATGEEKAATAPGAGAKASGEGMAGDAAGETEGSMERMGEP
SQDPKQGTSGGVDTSSEQIATLTGFPDFREHIAKIFEKPVLGALATPGEKAGAGRSAVGK
DLTRPLGPEKLLDGPPGVDVTLLPAPPARLQVEKKQQLAGEAEISHLALQDPASDKLLGP
AGLTWERNLPGAGVGKEMAGVPPTLREDERPEGPGAAWPGLEGQAYSQLERSRQELASGL
PSPAATQELPVERAAAFQVAPHSHGEEAVAQDRIPSGKQHQETSACDSPHGEDGPGDFAH
TGVPGHVPRSTCAPSPQREVLTVPEANSEPWTLDTLGGERRPGVTAGILEMRNALGNQST
PAPPTGEVADTPLEPGKVAGAAGEAEGDITLSTAETQACASGDLPEAGTTRTFSVVAGDL
VLPGSCQDPACSDKAPGMEGTAALHGDSPARPQQAKEQPGPERPIPAGDGKVCVSSPPEP
DETHDPKLQHLAPEELHTDRESPRPGPSMLPSVPKKDAPRVMDKVTSDETRGAEGTESSP
VADDIIQPAAPADLESPTLAASSYHGDVVGQVSTDLIAQSISPAAAHAGLPPSAAEHIVS
PSAPAGDRVEASTPSCPDPAKDLSRSSDSEEAFETPESTTPVKAPPAPPPPPPEVIPEPE
VSTQPPPEEPGCGSETVPVPDGPRSDSVEGSPFRPPSHSFSAVFDEDKPIASSGTYNLDF
DNIELVDTFQTLEPRASDAKNQEGKVNTRRKSTDSVPISKSTLSRSLSLQASDFDGASSS
GNPEAVALAPDAYSTGSSSASSTLKRTKKPRPPSLKKKQTTKKPTETPPVKETQQEPDEE
SLVPSGENLASETKTESAKTEGPSPALLEETPLEPAVGPKAACPLDSESAEGVVPPASGG
GRVQNSPPVGRKTLPLTTAPEAGEVTPSDSGGQEDSPAKGLSVRLEFDYSEDKSSWDNQQ
ENPPPTKKIGKKPVAKMPLRRPKMKKTPEKLDNTPASPPRSPAEPNDIPIAKGTYTFDID
KWDDPNFNPFSSTSKMQESPKLPQQSYNFDPDTCDESVDPFKTSSKTPSSPSKSPASFEI
PASAMEANGVDGDGLNKPAKKKKTPLKTDTFRVKKSPKRSPLSDPPSQDPTPAATPETPP
VISAVVHATDEEKLAVTNQKWTCMTVDLEADKQDYPQPSDLSTFVNETKFSSPTEELDYR
NSYEIEYMEKIGSSLPQDDDAPKKQALYLMFDTSQESPVKSSPVRMSESPTPCSGSSFEE
TEALVNTAAKNQHPVPRGLAPNQESHLQVPEKSSQKELEAMGLGTPSEAIEITAPEGSFA
SADALLSRLAHPVSLCGALDYLEPDLAEKNPPLFAQKLQEELEFAIMRIEALKLARQIAL
ASRSHQDAKREAAHPTDVSISKTALYSRIGTAEVEKPAGLLFQQPDLDSALQIARAEIIT
KEREVSEWKDKYEESRREVMEMRKIVAEYEKTIAQMIEDEQREKSVSHQTVQQLVLEKEQ
ALADLNSVEKSLADLFRRYEKMKEVLEGFRKNEEVLKRCAQEYLSRVKKEEQRYQALKVH
AEEKLDRANAEIAQVRGKAQQEQAAHQASLRKEQLRVDALERTLEQKNKEIEELTKICDE
LIAKMGKS
NT seq 8847 nt   +upstreamnt  +downstreamnt
atgggcaatgagaacagcacctcggacaaccagaggactttatcagctcagactccaagg
tccgcgcagccacccgggaacagtcagaatataaaaaggaagcagcaggacacgcccgga
agccctgaccacagagacgcgtccagcattggcagcgttgggcttggaggcttctgcacc
gcttctgagagttctgccagcctggatccatgccttgtgtccccagaggtgactgagcca
aggaaggacccacagggagccagggggccagaaggttctttgctgcccagcccaccaccg
tcccaggagcgagagcacccctcgtcctccatgccctttgccgagtgtcccccggaaggt
tgcttggcaagtccagcagcggcacctgaagatggtcctcagactcagtctcccaggagg
gaacctgccccaaatgccccaggagacatcgcggcggcatttcccgctgagagggacagc
tctactccataccaagagattgctgccgtccccagtgctggaagagagagacagccgaag
gaagaaggacagaagtcctccttctccttctccagtggcatcgaccagtcacctggaatg
tcgccagtacccctcagagagccaatgaaggcaccgctgtgtggagagggggaccagcct
ggtggttttgagtcccaagagaaagaggctgcaggtggctttccccctgcagagtccagg
cagggggtggcttctgtgcaagtgacccctgaggcccctgctgcagcccagcagggcaca
gaaagctcagcggtcttggagaagtcccccctaaaacccatggccccgatcccacaagat
ccagccccaagagcctcagacagagaaagaggccaaggggaggcgccgcctcagtattta
acagatgacttggaattcctcagggcctgccatctccctaggagcaattcaggggctgcc
ccagaagcagaagtgaatgccgcttcccaggagagctgccagcagccagtgggagcatat
ctgccgcacgcagagctgccctggggcttgccaagtcctgccctggtgccagaggctggg
ggctctgggaaggaggctctggacaccattgatgttcagggtcacccacagacagggatg
cgaggaaccaagcccaatcaagttgtctgtgtggcagcaggcggccagcccgaagggggt
ttgcctgtgagccctgaaccttccctgctcactccgactgaggaagcacatccagcttca
agcctcgcttcattcccagctgctcagattcctattgctgtagaagaacctggatcatca
tccagggaatcagtttccaaggctgggatgccagtttctgcagatgcagccaaagaggtg
gtggatgcagggttggtgggactggagaggcaggtgtcagatcttggaagcaagggagag
catccagaaggggaccctggagaggttcctgccccatcaccccaggagaggggagagcac
ttgaacacggagcaaagccatgaggtccaaccaggagtaccaccccctcctcttcccaag
gagcaaagccatgaggtccaaccaggagcaccaccccctcctcttcccaaggcaccaagt
gaaagtgccagagggccaccggggccaacggatggagccaaggtccatgaagattccaca
agcccagccgtggctaaagaaggaagcagatcacctggtgacagccctggaggaaaggag
gaagccccagagccacctgatggtggagacccagggaacctgcaaggagaggactctcag
gctttcagcagcaagcgtgatccagaagtaggcaaagatgagctttcaaagccaagcagt
gatgcagagagcagagaccatcccagctcacactcagcacagccacccagaaaggggggt
gctgggcacacggacgggccccactctcagacagcagaggctgatgcatctggcctacca
cacaagctgggtgaggaggaccccgtcctgccccctgtgccagatggagctggtgagccc
actgttcccgaaggagccatctgggaggggtcaggattgcagcccaaatgtcctgacacc
cttcagagcagggaaggattgggaagaatggagtctttcctgactttagaatcagagaaa
tcagattttccaccaactcctgttgcagaggttgcacccaaagcccaggaaggtgagagc
acattggaaataaggaagatgggcagctgtgatggggagggcttgctgacgtccccagat
caaccccgcgggccggcgtgtgatgcgtcgagacaggaatttcatgctggggtgccacat
cccccccagggggagaacttggcagcagacctggggctcacggcactcatcctggaccaa
gatcagcagggaatcccatcctgcccaggggaaggctggataagaggagctgcatccgag
tggcccctactatcttctgagaagcatctccagccatcccaggcacaaccagagacatcc
atctttgacgtgctcaaggagcaggcccagccacctgaaaatgggaaagagacttctcca
agccatccaggttttaaggaccagggagcagattcttcccaaatccatgtacctgtggaa
cctcaggaagataacaacttgcccactcatggaggacaggagcaggctttgggatcagaa
cttcaaagtcagctccccaaaggcaccctgtctgatactccaacttcatctcccactgac
atggtttgggagagttctctgacagaagagtcagaattgtcagcaccaacgagacagaag
ttgcctgcactaggggagaagcggccagagggagcatgcggtgatggtcagtcctcgagg
gtctcgcctccagcagcagatgtcttaaaagacttttctcttgcagggaacttcagcaga
aaggaaacttgctgcactgggcaggggccaaacaagtctcaacaggcattggctgatgcc
ttggaagaaggcagccagcatgaagaagcatgtcaaaggcatccaggagcttctgaagca
gctgatggttgttccccactctggggcttgagtaagagggagatggcaagtggaaacaca
ggggaggccccaccttgtcagcctgactcagtagctctcctggatgcagttccctgcctg
ccagccctggcgcccgccagccccggagtcacacccacccaggatgccccagagacagag
gcatgtgatgaaacccaggaaggcaggcagcaaccagtgccggccccgcagcagaaaatg
gagtgctgggccacttcggatgcagagtccccaaagcttcttgcaagtttcccatcagct
ggggagcaaggtggtgaagccggggctgctgagactggtggcagcgctggtgcaggagac
ccaggaaagcagcaggctccggagaaacctggagaagctactttgagttgtggcctcctt
cagactgagcactgccttacctccggggaggaagcttctacctctgccctacgtgagtcc
tgccaagctgagcaccccatggccagctgccaggatgccttgctgccagccagagagctg
ggtgggattcccaggagcaccatggatttttctacacaccaggctgtcccagacccaaag
gagctcctgctgtctgggccaccagaagtggctgctcctgacaccccttacctgcatgtc
gacagtgctgcccagagaggagcagaagacagtggagtgaaagctgtttcctctgcagac
cccagagctcctggcgaaagcccctgtcctgtaggggagcccccacttgccttggaaaat
gctgcctccttgaagctgtttgctggctccctcgcccccctgttgcaaccaggagctgca
ggtggggaaatccctgcagtgcaagccagcagtggtagtcccaaagccagaaccactgag
ggaccagtggactccatgccatgcctggaccggatgccacttctggccaagggcaagcag
gcaacaggggaagagaaagcagcaacagctccaggtgcaggtgccaaggccagtggggag
ggcatggcaggtgatgcagcaggagagacagagggcagcatggagaggatgggagagcct
tcccaggacccaaagcagggcacatcaggtggtgtggacacaagctctgagcaaatcgcc
accctcactggcttcccagacttcagggagcacatcgccaagatcttcgagaagcctgtg
ctcggagccctggccacacctggagaaaaggcaggagctgggaggagtgcagtgggtaaa
gacctcaccaggccattgggcccagagaagcttctagatgggcctccaggagtggatgtc
acccttctccctgcacctcctgctcgactccaggtggagaagaagcaacagttggctgga
gaggctgagatttcccatctggctctgcaagatccagcttcagacaagcttctgggtcca
gcagggctgacctgggagcggaacttgccaggtgccggtgtggggaaggagatggcaggt
gtcccacccacactgagggaagacgagaggccagaggggcctggggcagcctggccaggc
ctggaaggccaggcttactcacagctggagaggagcaggcaggaattagcttcaggtctt
ccttcaccagcagctactcaggagctccctgtggagagagctgctgccttccaggtggct
ccccatagccatggagaagaggccgtggcccaagacagaattccttctggaaagcagcac
caggaaacatctgcctgcgacagtccacatggagaagatggtcccggggactttgctcac
acaggggttccaggacatgtgccaaggtccacgtgtgccccttctcctcagagggaggtt
ttgactgtgcctgaggccaacagtgagccctggacccttgacacgcttgggggtgaaagg
agacccggagtcactgctggcatcttggaaatgcgaaatgccctgggcaaccagagcacc
cctgcaccaccaactggagaagtggcagacactcccctggagcctggcaaggtggcaggc
gctgctggggaagcagagggtgacatcaccctgagcacagctgagacacaggcatgtgcg
tccggtgatctgcctgaagcaggtactacgaggacattctccgttgtggcaggtgacttg
gtgctgccaggaagctgtcaggacccagcctgctctgacaaggctccggggatggagggt
acagctgcccttcatggggacagcccagccaggccccagcaggctaaggagcagccaggg
cctgagcgccccattccagctggggatgggaaggtgtgcgtctcctcacctccagagcct
gacgaaactcacgacccgaagctgcaacatttggctccagaagagctccacactgacaga
gagagccccaggcctggcccatccatgttaccttcggttcctaagaaggatgctccaaga
gtcatggataaagtcacttcagatgagaccagaggtgcggaaggaacagaaagttcacct
gtggcagatgatatcatccagcccgctgcccccgcagacctggaaagcccaaccttagct
gcctcttcctaccacggtgatgttgttggccaggtctctacggatctgatagcccagagc
atctccccagctgctgcccatgcgggtcttcctccctcggctgcagaacacatagtttcg
ccatctgccccagctggtgacagagtagaagcttccactccctcctgcccagatccggcc
aaggacctcagcaggagttccgattctgaagaggcatttgagaccccggagtcaacgacc
cctgtcaaagctccgccagctccacccccaccaccccccgaagtcatcccagaacccgag
gtcagcacacagccacccccggaagaaccaggatgtggttctgagacagtccctgtccct
gatggcccacggagcgactcggtggaaggaagtcccttccgtcccccgtcacactccttc
tctgccgtcttcgatgaagacaagccgatagccagcagtgggacttacaacttggacttt
gacaacattgagcttgtggatacctttcagaccttggagcctcgtgcctcagacgctaag
aatcaggagggcaaagtgaacacacggaggaagtccacggattccgtccccatctctaag
tctacactgtcccggtcgctcagcctgcaagccagtgactttgatggtgcttcttcctca
ggcaatcccgaggccgtggcccttgccccagatgcatatagcacgggttccagcagtgct
tctagtacccttaagcgaactaaaaaaccgaggccgccttccttaaaaaagaaacagacc
accaagaaacccacagagacccccccagtgaaggagacgcaacaggagccagatgaagag
agccttgtccccagtggggagaatctagcatctgagacgaaaacggaatctgccaagacg
gaaggtcctagcccagccttattggaggagacgccccttgagcccgctgtggggcccaaa
gctgcctgccctctggactcagagagtgcagaaggggttgtccccccggcttctggaggt
ggcagagtgcagaactcaccccctgtcgggaggaaaacgctgcctcttaccacggccccg
gaggcaggggaggtaaccccatcggatagcggggggcaagaggactctccagccaaaggg
ctctccgtaaggctggagtttgactattctgaggacaagagtagttgggacaaccagcag
gaaaacccccctcctaccaaaaagataggcaaaaagccagttgccaaaatgcccctgagg
aggccaaagatgaaaaagacacccgagaaacttgacaacactcctgcctcacctcccaga
tcccctgctgaacccaatgacatccccattgctaaaggtacttacacctttgatattgac
aagtgggatgaccccaattttaaccctttttcttccacctcaaaaatgcaggagtctccc
aaactgccccaacaatcatacaactttgacccagacacctgtgatgagtccgttgacccc
tttaagacatcctctaagacccccagctcaccttctaaatccccagcctcctttgagatc
ccagccagtgctatggaagccaatggagtggacggggatgggctaaacaagcccgccaag
aagaagaagacgcccctaaagactgacacatttagggtgaaaaagtcgccaaaacggtct
cctctctctgatccaccttcccaggaccccaccccagctgctacaccagaaacaccacca
gtgatctctgcggtggtccacgccacagatgaggaaaagctggcggtcaccaaccagaag
tggacgtgcatgacagtggacctagaggctgacaaacaggactacccgcagccctcggac
ctgtccacctttgtaaacgagaccaaattcagttcacccactgaggagttggattacaga
aactcctatgaaattgaatatatggagaaaattggctcctccttacctcaggacgacgat
gccccgaagaagcaggccttgtaccttatgtttgacacttctcaggagagccctgtcaag
tcatctcccgtccgcatgtcagagtccccgacgccgtgttcagggtcaagttttgaagag
actgaagcccttgtgaacactgctgcgaaaaaccagcatcctgtcccacgaggactggcc
cctaaccaagagtcacacttgcaggtgccagagaaatcctcccagaaggagctggaggcc
atgggcttgggcaccccttcagaagcgattgaaattacagctcccgagggctcctttgcc
tctgctgacgccctcctcagcaggctagctcaccccgtctctctctgtggtgcacttgac
tatctggagcccgacttagcagaaaagaaccccccactattcgctcagaaactccaggag
gagttagagtttgccatcatgcggatagaagccctgaagctggccaggcagattgctttg
gcttcccgcagccaccaggatgccaagagagaggctgctcacccaacagacgtctccatc
tccaaaacagccttgtactcccgcatcgggaccgctgaggtggagaaacctgcaggcctt
ctgttccagcagcccgacctggactctgccctccagatcgccagagcagagatcataacc
aaggagagagaggtctcagaatggaaagataaatatgaagaaagcaggcgggaagtgatg
gaaatgaggaaaatagtggccgagtatgagaagaccatcgctcagatgatagaggacgaa
cagagagagaagtcagtctcccaccagacggtgcagcagctggttctggagaaggagcaa
gccctggccgacctgaactccgtggagaagtctctggccgacctcttcagaagatatgag
aagatgaaggaggtcctagaaggcttccgcaagaatgaagaggtgttgaagagatgtgcg
caggagtacctgtcccgggtgaagaaggaggagcagaggtaccaggccctgaaggtgcac
gcggaggagaaactggacagggccaatgctgagattgctcaggttcgaggcaaggcccag
caggagcaagccgcccaccaggccagcctgcggaaggagcagctgcgagtggacgccctg
gaaaggacgctggagcagaagaataaagaaatagaagaactcaccaagatttgtgacgaa
ctgattgccaaaatggggaaaagctaa

DBGET integrated database retrieval system