KEGG   Homo sapiens (human): 1058Help
Entry
1058              CDS       T01001                                 

Gene name
CENPA, CENP-A, CenH3
Definition
(RefSeq) centromere protein A
  KO
K11495  histone H3-like centromeric protein A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1058 (CENPA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     1058 (CENPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CBFD_NFYB_HMF CENP-S
Motif
Other DBs
NCBI-GeneID: 1058
NCBI-ProteinID: NP_001800
OMIM: 117139
HGNC: 1851
Ensembl: ENSG00000115163
Vega: OTTHUMG00000097073
Pharos: P49450(Tbio)
UniProt: P49450
Structure
PDB: 

Position
2p23.3
AA seq 140 aa AA seqDB search
MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHL
LIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVT
LFPKDVQLARRIRGLEEGLG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgggcccgcgccgccggagccgaaagcccgaggccccgaggaggcgcagcccgagcccg
accccgacccccggcccctcccggcggggcccctccttaggcgcttcctcccatcaacac
agtcggcggagacaaggttggctaaaggagatccgaaagcttcagaagagcacacacctc
ttgataaggaagctgcccttcagccgcctggcaagagaaatatgtgttaaattcactcgt
ggtgtggacttcaattggcaagcccaggccctattggccctacaagaggcagcagaagca
tttctagttcatctctttgaggacgcctatctcctcaccttacatgcaggccgagttact
ctcttcccaaaggatgtgcaactggcccggaggatccggggccttgaggagggactcggc
tga

DBGET integrated database retrieval system