KEGG   Homo sapiens (human): 10589
Entry
10589             CDS       T01001                                 
Symbol
DRAP1, NC2-alpha
Name
(RefSeq) DR1 associated protein 1
  KO
K21752  Dr1-associated corepressor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10589 (DRAP1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     10589 (DRAP1)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone FXMRP1_C_core
Other DBs
NCBI-GeneID: 10589
NCBI-ProteinID: NP_006433
OMIM: 602289
HGNC: 3019
Ensembl: ENSG00000175550
Pharos: Q14919(Tbio)
UniProt: Q14919
Structure
Position
11:65919426..65921563
AA seq 205 aa
MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRK
NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFA
STLPLPPAPPGPSAPDEEDEEDYDS
NT seq 618 nt   +upstreamnt  +downstreamnt
atgccgagcaagaagaagaagtacaacgcgcggttcccgccggcgcggatcaagaagatc
atgcagacggacgaagagattgggaaggtggcggcggcggtgcctgtcatcatctcccgg
gcgctcgagctcttcctagagtcgctgttgaagaaggcctgccaggtgacccagtcgcgg
aacgcgaagaccatgaccacatcccacctgaagcagtgcatcgagctggagcagcagttt
gacttcttgaaggacctggtggcatctgttcccgacatgcagggggacggggaagacaac
cacatggatggggacaagggcgcccgcaggggccggaagccaggcagcggcggccggaag
aacggtgggatgggaacgaaaagcaaggacaagaagctgtccgggacagactcggagcag
gaggatgaatctgaggacacagatactgatggggaagaggagacatcacaacccccaccc
caggccagccacccctctgcccactttcagagccccccgacacccttcctgcccttcgcc
tctactctgcctttgcccccagcgcccccgggcccctcagcacctgatgaagaggacgaa
gaagattacgactcctag

DBGET integrated database retrieval system