KEGG   Homo sapiens (human): 10592Help
Entry
10592             CDS       T01001                                 

Gene name
SMC2, CAP-E, CAPE, SMC-2, SMC2L1
Definition
(RefSeq) structural maintenance of chromosomes 2
  KO
K06674  structural maintenance of chromosome 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10592 (SMC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Chromosome condensation proteins
   Condensin I
    10592 (SMC2)
   Condensin II
    10592 (SMC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_23 AAA_21 AAA_15 AAA_29 DUF4200
Motif
Other DBs
NCBI-GeneID: 10592
NCBI-ProteinID: NP_001036015
OMIM: 605576
HGNC: 14011
Ensembl: ENSG00000136824
Vega: OTTHUMG00000020401
Pharos: O95347(Tbio)
UniProt: O95347 A0A024R158 Q6IPS5 Q05BV1 B3KMB1
Structure
PDB: 

Position
9q31.1
AA seq 1197 aa AA seqDB search
MHIKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRAS
NLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGV
NANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIA
AQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFL
LAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHEIEELEKRKDKETGGILRSLE
DALAEAQRVNTKSQSAFDLKKKNLACEESKRKELEKNMVEDSKTLAAKEKEVKKITDGLH
ALQEASNKDAEALAAAQQHFNAVSAGLSSNEDGAEATLAGQMMACKNDISKAQTEAKQAQ
MKLKHAQQELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLE
KRRQLSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTA
LELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGP
DNVHVALSLVEYKPELQKAMEFVFGTTFVCDNMDNAKKVAFDKRIMTRTVTLGGDVFDPH
GTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEEELAGLKNTAEKYRQLKQQWE
MKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKM
KNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQL
EAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHK
EQNNDSQLKIKELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTN
NPKEAGQRLQKLQEMKEKLGRNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIE
DLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKE
NLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQF
IVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPPKGAHVEV
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
atgcatattaagtcaattattctagagggattcaagtcctatgctcagaggaccgaagtc
aatggttttgaccccctcttcaatgctatcactggcttaaatggtagtgggaaatccaac
atattggactccatctgctttttgctgggcatctccaacctgtctcaggttcgggcttct
aatttacaagatttagtttacaaaaatgggcaggctggtattaccaaagcctctgtgtca
atcacttttgataattctgacaaaaagcaaagtcctttaggatttgaggttcatgatgaa
atcacagtaacaaggcaggtggttattggtggtagaaataaatatttaatcaatggagtc
aatgccaacaacaccagagtacaggatctcttctgttctgttggccttaatgttaacaac
cctcactttctcatcatgcagggccgaattacaaaagtattgaatatgaaacctccagag
attttatccatgatagaagaagcagctggaaccaggatgtatgaatacaaaaaaatagct
gcacagaaaactatagaaaaaaaggaggctaagctgaaagaaattaagacgatacttgaa
gaagagattactccaaccattcaaaaattaaaagaggaaagatcgtcctacttggagtac
caaaaagtaatgagagaaatagaacatttgagtcgtttatatattgcttatcagtttttg
ctggctgaagataccaaagtacgctcagctgaggaattaaaagaaatgcaagataaagtt
ataaagcttcaggaagaattgtctgagaatgataaaaaaataaaagcacttaatcatgaa
atagaagaattggaaaaaagaaaagataaggaaactggaggtatacttcgatctttagaa
gatgctcttgcagaggctcagcgagttaatactaaatctcaaagcgcatttgatctcaag
aagaaaaatctggcatgtgaggaaagcaaacgcaaagagctggaaaaaaatatggttgag
gactcaaaaactttagcagcaaaggaaaaagaggttaaaaagataacagatggactgcat
gcccttcaagaagcaagtaataaagatgctgaagctctggcagctgcacagcagcacttc
aatgctgtttccgctggcctgtccagtaatgaagatggagcagaagcaactcttgctggt
caaatgatggcctgtaaaaatgatataagtaaagctcagacagaagccaaacaggctcag
atgaagttgaagcatgctcaacaggaattaaagaataaacaagctgaagttaagaagatg
gatagtggctacaggaaggatcaagaagctctagaagctgtaaaaagacttaaagaaaaa
cttgaagctgaaatgaaaaagctaaattatgaagaaaataaagaggaaagccttttggaa
aagcgcaggcagctgtctcgtgatattggtagattgaaagaaacatatgaagctctatta
gccagatttcccaatcttcgatttgcatacaaggatccagagaagaactggaatagaaat
tgtgtgaaaggacttgtggcttctctgattagtgtgaaagacacttctgcaaccacagct
ttagaattagtggctggagaacgactctacaatgttgtagtagacacagaagttactggt
aaaaagctactagaaaggggggaactgaaacgtcgatacactataattccactcaataaa
atttcagccagatgtattgcaccagaaactctgagagttgctcagaatcttgttggccct
gacaacgttcatgtggctctttccttggttgaatataaaccagaacttcagaaagcaatg
gagtttgtctttggaacaacatttgtttgtgacaatatggataatgccaaaaaagtggcc
tttgataagaggataatgactagaactgtaactctcggaggtgatgtgtttgatcctcat
gggacattgagtggaggtgctcgatcccaggcagcttccattttaaccaagtttcaagaa
ctcaaagatgttcaggatgaactgagaatcaaagagaatgagctgcgggctctagaagag
gaattagcaggtcttaaaaacactgctgaaaagtatcgccaactaaaacagcagtgggag
atgaaaactgaagaggcagatttattacaaaccaagctccagcaaagctcatatcacaag
caacaagaagaattagatgcccttaaaaaaaccattgaggaaagtgaggagactttgaaa
aacactaaagaaatccaaagaaaagcagaagaaaaatatgaagtattggaaaataaaatg
aaaaatgcagaagctgaaagagagcgagaactgaaagatgctcagaaaaaactggattgt
gccaaaacaaaggcagatgcatctagcaagaagatgaaagaaaaacaacaggaagttgaa
gctatcactctggaactggaagagctcaagagagagcatacatcttacaaacaacagctt
gaagctgtaaatgaagctatcaaatcctatgaaagtcagattgaagtaatggcagctgag
gtggctaaaaataaggagtcagtaaataaagctcaagaagaggtgaccaagcaaaaagag
gtgataacagcccaagacactgtaattaaagctaaatatgcagaagtggcaaaacacaag
gagcaaaacaatgattctcagcttaaaattaaggaattagaccacaacatcagcaaacat
aaacgggaggctgaagatggtgctgcaaaggtatccaaaatgttgaaagattatgactgg
attaatgcagagagacacctctttggccaacccaatagtgcctatgatttcaaaactaac
aaccctaaagaagctggtcagagacttcagaagttgcaagaaatgaaggagaaactagga
agaaatgtcaatatgagagctatgaatgtattgacagaagctgaagagcgatacaatgac
ttgatgaagaagaagagaattgtagaaaatgacaaatccaaaattcttacaactatagaa
gaccttgaccagaagaaaaaccaagccctaaatattgcatggcaaaaggtgaacaaggac
tttgggtctattttttctactcttttgcctggtgctaatgctatgcttgcaccaccagag
ggtcaaactgttttggatggtctggagttcaaggttgccttgggaaatacctggaaagaa
aacctaactgaacttagtggtggtcagaggtctttagtggccttgtcattaatactgtcc
atgcttctcttcaaacctgctccaatttatatccttgatgaggtagatgcagccttggat
ctttctcatacccaaaacattggacagatgctgcgtactcatttcacacattctcagttc
attgtggtgtcactaaaagaaggtatgttcaacaatgcaaacgttcttttcaaaaccaag
tttgtggatggtgtttctacagtagccagatttactcaatgtcaaaatggaaagatttca
aaggaagcaaaatccaaggcaaaaccacccaaaggagcacatgtggaagtttaa

DBGET integrated database retrieval system