KEGG   Homo sapiens (human): 1060
Entry
1060              CDS       T01001                                 

Gene name
CENPC, CENP-C, CENPC1, MIF2, hcp-4
Definition
(RefSeq) centromere protein C
  KO
K11497  centromere protein C
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1060 (CENPC)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     1060 (CENPC)
    Mis6 complex
     1060 (CENPC)
SSDB
Motif
Pfam: CENP_C_N CENP-C_mid CENP-C_C Cupin_2
Other DBs
NCBI-GeneID: 1060
NCBI-ProteinID: NP_001803
OMIM: 117141
HGNC: 1854
Ensembl: ENSG00000145241
Vega: OTTHUMG00000160735
Pharos: Q03188(Tbio)
UniProt: Q03188
Structure
PDB: 

Position
4q13.2
AA seq 943 aa
MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVP
NSTRKIKDTCIQSPSKECQKSHPKSVPVSSKKKEASLQFVVEPSEATNRSVQAHEVHQKI
LATDVSSKNTPDSKKISSRNINDHHSEADEEFYLSVGSPSVLLDAKTSVSQNVIPSSAQK
RETYTFENSVNMLPSSTEVSVKTKKRLNFDDKVMLKKIEIDNKVSDEEDKTSEGQERKPS
GSSQNRIRDSEYEIQRQAKKSFSTLFLETVKRKSESSPIVRHAATAPPHSCPPDDTKLIE
DEFIIDESDQSFASRSWITIPRKAGSLKQRTISPAESTALLQGRKSREKHHNILPKTLAN
DKHSHKPHPVETSQPSDKTVLDTSYALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQK
QRRKFMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPP
VGSKKSSTRKDKEESKKKRFSSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEESPV
YSNSSVRNELPMHHNSSRKSTKKTNQSSKNIRKKTIPLKRQKTATKGNQRVQKFLNAEGS
GGIVGHDEISRCSLSEPLESDEADLAKKKNLDCSRSTRSSKNEDNIMTAQNVPLKPQTSG
YTCNIPTESNLDSGEHKTSVLEESGPSRLNNNYLMSGKNDVDDEEVHGSSDDSKQSKVIP
KNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISGVLSPDTISSK
RKAKENIGKVNKKSNKKRICLDNDERKTNLMVNLGIPLGDPLQPTRVKDPETREIILMDL
VRPQDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFYVNFGDLL
CTLHETPYILSTGDSFYVPSGNYYNIKNLRNEESVLLFTQIKR
NT seq 2832 nt   +upstreamnt  +downstreamnt
atggctgcgtccggtctggatcatctcaaaaatggctacagaagaagattttgtcgacct
tccagggcacgtgacattaacacagagcaaggccagaatgttctggaaatcttacaagac
tgttttgaagaaaaaagtcttgccaatgattttagtacaaattctacaaaatcagtgcct
aattcaacacgcaaaataaaagacacttgtattcagtcaccaagcaaagagtgccagaaa
tcacatccaaagtcagttccagtttcttcaaagaagaaagaagcctctctacagtttgtt
gtagaaccaagtgaagccacaaacagatcagttcaggcccatgaagttcatcagaaaatt
ctggcaactgatgttagttccaaaaatacacctgactcgaaaaaaatatcaagtagaaac
ataaatgatcatcacagtgaagctgatgaagaattttacttatccgttggctcaccttct
gttcttttggatgcaaaaacatctgtatcacaaaatgttattccatctagtgcccaaaag
agagagacttacacttttgaaaattcagtaaatatgctgccttcaagtacagaggtttca
gttaaaaccaaaaaaaggttaaactttgatgataaagttatgttaaagaaaatagaaata
gataataaagtatcagatgaagaggataaaacatcggaaggacaagaaagaaaaccatca
ggatcatctcagaatagaatacgagattcagaatatgaaattcaacgacaagctaaaaaa
agtttttcaacattgtttttagaaacagtaaaacgaaaaagtgaatccagtcccattgtt
aggcatgcggcaactgctccacctcattcgtgtcctcccgatgatacgaagttgatagag
gatgaatttataattgatgagtcggatcaaagttttgccagtagatcttggattacaata
ccaagaaaggcagggtctctgaaacaacgcacaatatccccggctgagagcactgcactc
cttcaaggtagaaagtcaagagaaaagcatcataatatattacctaagactttggcaaat
gacaaacattcccataaacctcacccagtagagacatctcagccctctgataaaacagta
ctggatacaagttatgctttgataggtgaaacagtaaataattatagatctacaaaatat
gaaatgtattccaagaatgcagaaaaaccatctagaagcaaaaggactataaaacaaaaa
cagagaagaaaattcatggctaaaccagctgaagaacagcttgatgtgggacagtctaaa
gatgaaaacatacatacatcacatattacccaagacgaatttcaaagaaattcagacaga
aatatggaagagcatgaagagatgggaaatgattgtgtttccaaaaaacagatgccacct
gtgggaagcaagaaaagtagcactagaaaagataaggaagaatctaaaaagaagcgcttt
tccagtgagtccaagaacaaacttgtacctgaagaagtgacttcaactgtcacgaaaagt
cgaagaatttccaggcgtccatctgattggtgggtggtaaaatcagaggagagtcctgtt
tatagcaattcttcagtaagaaatgaattaccaatgcatcacaatagtagccgaaaatct
actaagaaaacaaatcagtcatctaagaatattaggaaaaaaactattccacttaaaagg
cagaagacagcaactaaaggcaaccaaagagtacagaagtttttaaatgctgaaggttct
ggaggtatcgttggtcatgatgaaatttccagatgttcgctgagtgagccattggaaagt
gatgaggcagacttggctaagaagaaaaatcttgattgttctagatctacaagaagctca
aagaatgaagataacattatgactgcacagaatgttcccctaaagcctcagaccagtgga
tatacatgtaatataccaacagagtcaaacttggattctggagagcataagacttcagtt
ttagaggaaagtggaccttccaggctcaataataattatttaatgtctggaaagaatgat
gtggatgatgaggaagttcatggaagttcagatgactcaaaacaatctaaagtgatacca
aagaacagaatccatcacaaactagtattgccctccaacacaccaaatgttcgcaggacc
aagagaacacgtttgaaacctttggagtactggcgaggagagcgaatagattatcaagga
aggccatcaggaggattcgtgattagtggagtactatctccagacacaatatcgtctaaa
aggaaggcaaaagaaaatattggaaaagtcaacaaaaaatctaataagaaaaggatctgt
cttgataacgatgaaagaaagactaacttaatggtaaatctaggtatacctcttggagat
cctttgcagccaacgagggtaaaggacccagaaacaagagagattattctcatggatctt
gtaaggccacaagatacatatcaattttttgttaagcatggtgagttgaaggtatacaag
acattggatacaccctttttttctactgggaaattgatattaggaccacaagaagaaaag
ggaaagcagcatgttggccaggatatattggttttttatgttaactttggtgaccttttg
tgtactttacatgaaacaccttatatattaagtactggggattcgttctatgttccttca
ggtaactattataacatcaaaaatctccggaatgaggaaagtgttcttctttttactcag
ataaaaagatga

DBGET integrated database retrieval system