KEGG   Homo sapiens (human): 10600
Entry
10600             CDS       T01001                                 
Symbol
USP16, UBP-M, UBPM
Name
(RefSeq) ubiquitin specific peptidase 16
  KO
K11844  ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10600 (USP16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10600 (USP16)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     10600 (USP16)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   10600 (USP16)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    10600 (USP16)
SSDB
Motif
Pfam: UCH zf-UBP DapB_C
Other DBs
NCBI-GeneID: 10600
NCBI-ProteinID: NP_001027582
OMIM: 604735
HGNC: 12614
Ensembl: ENSG00000156256
Pharos: Q9Y5T5(Tbio)
UniProt: Q9Y5T5
Structure
Position
21:29024668..29054488
AA seq 823 aa
MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
AEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCD
NEVQYCSSNQLGQVVDYVRKQASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENM
AKENPPMNSPCQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPD
LALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQQDS
QELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSMPSFVDRIFG
GELTSMIMCDQCRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKD
NDSYIKERSDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSE
YEAEMSLQGEVNIKSNHISQEGVMHKEYCVNQKDLNGQAKMIESVTDNQKSTEEVDMKNI
NMDNDLEVLTSSPTRNLNGAYLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHT
PGTKVYEVVNEDPETAFCTLANREVFNTDECSIQHCLYQFTRNEKLRDANKLLCEVCTRR
QCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEIL
DLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANSHLSNLVLHGD
IPQDFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgggaaagaaacggacaaagggaaaaactgttccaatcgatgattcctctgaaacttta
gaacctgtgtgcagacacattagaaaaggattggaacaaggtaatttgaaaaaggcttta
gtgaatgtggaatggaatatctgccaagactgtaagactgacaataaagtgaaagataaa
gctgaagaagaaacagaagaaaagccttcagtttggctgtgtcttaaatgtggccatcag
ggctgtggcagaaattctcaggagcagcatgccttgaagcactatctgacgccaagatct
gaacctcactgtctggttcttagtttggacaactggagtgtatggtgttacgtatgtgat
aatgaggtccagtattgtagttcaaaccagttgggtcaagtggttgattatgtcagaaaa
caagccagcattacaactccaaagccagcagagaaagataatggaaatattgaacttgaa
aataaaaaattagaaaaagagagtaagaatgaacaagagagagaaaagaaggaaaacatg
gctaaagagaatcctcccatgaattctccttgccaaataaccgtgaaaggactcagtaat
ttgggaaacacatgtttcttcaatgcagttatgcagaacttgtcacaaacaccagtgctt
agagaactactaaaagaagtgaaaatgtctggaacaattgtaaaaattgaaccacctgat
ttggcattaacagaaccattagaaataaaccttgagcctccaggccctcttactttagcc
atgagccagtttcttaatgagatgcaagagaccaaaaagggggttgtgacaccgaaagaa
ctcttttctcaggtctgtaaaaaagcagtgcggtttaaaggctatcagcagcaagacagc
caggagctgcttcgctacttattggatgggatgagagcagaagaacaccaaagagtgagt
aaaggaatacttaaagcatttggtaattctactgaaaagttggatgaagaactaaaaaat
aaagttaaagattatgagaagaaaaaatcaatgccaagttttgttgaccgcatctttggt
ggtgaactaactagtatgatcatgtgtgatcaatgcagaactgtctccttggttcatgaa
tctttccttgatttgtccctcccagttttagatgatcagagtggtaagaaaagtgtaaat
gataaaaatctgaaaaagacagtggaggatgaagatcaagatagtgaggaagaaaaagat
aacgacagttacataaaagagagaagtgatattccttctggaacaagtaagcacttacag
aaaaaagcaaagaaacaagccaaaaagcaagccaagaaccaacgaagacaacaaaaaatt
caaggaaaagttcttcatttaaatgatatttgtactattgaccatcctgaagacagtgaa
tatgaagctgaaatgtcacttcaaggagaagtaaatattaaatccaaccatatttcacaa
gagggtgttatgcataaagaatattgtgtcaaccagaaagatttgaatggccaagcaaaa
atgatcgaaagtgtaactgacaatcaaaaatccacagaggaagtagatatgaaaaatatc
aacatggataatgatctggaggttttaacatcttctcccactaggaatttaaatggtgcc
tacctaacggaagggagcaatggagaagtggacatttccaatggtttcaaaaacctaaat
ttgaatgctgctcttcatcctgatgaaataaatatagagattctgaatgatagtcatact
cctggaacaaaggtgtatgaggttgtaaatgaagatccagaaactgctttctgtactctt
gcaaacagggaagttttcaatactgatgagtgttcaatccaacattgtttatatcagttc
acccgtaatgagaaacttcgagatgcgaataaactgctttgtgaagtatgcacacggaga
cagtgtaatggaccaaaggcaaatataaaaggtgaaaggaagcatgtttacaccaatgcc
aaaaagcagatgctaatttctcttgctcctcctgttcttactcttcatttaaagagattt
cagcaggctggttttaacctacgcaaagttaacaaacacataaagtttccggaaatctta
gatttggctcctttttgcacccttaaatgtaagaatgttgcagaagaaaatacaagggta
ctctattccttatatggagttgttgaacacagtggtactatgaggtcggggcattacact
gcctatgccaaggcaagaaccgcaaatagtcatctctctaatcttgttcttcacggtgat
attccacaagattttgaaatggaatcaaaagggcagtggtttcacatcagcgacacacat
gtgcaagctgtgcctacaactaaagtactaaactcacaagcgtacctcctattttatgag
agaatactgtaa

DBGET integrated database retrieval system