KEGG   Homo sapiens (human): 10611Help
Entry
10611             CDS       T01001                                 

Gene name
PDLIM5, ENH, ENH1, L9, LIM
Definition
(RefSeq) PDZ and LIM domain 5
  KO
K19867  LIM domain-binding protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    10611 (PDLIM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM PDZ DUF4749 PDZ_6 PDZ_2
Motif
Other DBs
NCBI-GeneID: 10611
NCBI-ProteinID: NP_006448
OMIM: 605904
HGNC: 17468
Ensembl: ENSG00000163110
Vega: OTTHUMG00000130973
Pharos: Q96HC4(Tbio)
UniProt: Q96HC4 A0A024RDE8
Structure
PDB: 

Position
4q22.3
AA seq 596 aa AA seqDB search
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQG
MTHLEAQNKIKGCTGSLNMTLQRASAAPKPEPVPVQKGEPKEVVKPVPITSPAVSKVTST
NNMAYNKAPRPFGSVSSPKVTSIPSPSSAFTPAHATTSSHASPSPVAAVTPPLFAASGLH
ANANLSADQSPSALSAGKTAVNVPRQPTVTSVCSETSQELAEGQRRGSQGDSKQQNGPPR
KHIVERYTEFYHVPTHSDASKKRLIEDTEDWRPRTGTTQSRSFRILAQITGTEHLKESEA
DNTKKANNSQEPSPQLASSVASTRSMPESLDSPTSGRPGVTSLTAAAAFKPVGSTGVIKS
PSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKRTPMC
AHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKFFAPECG
RCQRKILGEVISALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHG
CEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactacagtgtgtcactggttggcccagctccttggggtttccggctgcagggc
ggtaaggatttcaacatgcctctgacaatctctagtctaaaagatggcggcaaggcagcc
caggcaaatgtaagaataggcgatgtggttctcagcattgatggaataaatgcacaagga
atgactcatcttgaagcccagaataagattaagggttgtacaggctctttgaatatgact
ctgcaaagagcatctgctgcacccaagcctgagccggttcctgttcaaaagggagaacct
aaagaagtagttaaacctgtgcccattacatctcctgctgtgtccaaagtcacttccaca
aacaacatggcctacaataaggcaccacggccttttggttctgtgtcttcaccaaaagtc
acatccatcccatcaccatcgtctgccttcaccccagcccatgcgaccacctcatcacat
gcttccccttcacccgtggctgccgtcactcctcccctgttcgctgcatctggactgcat
gctaatgccaatcttagtgctgaccagtctccatctgcactgagcgctggtaaaactgca
gttaatgtcccacggcagcccacagtcaccagcgtgtgttccgagacttctcaggagcta
gcagagggacagagaagaggatcccagggtgacagtaaacagcaaaatggcccaccaaga
aaacacattgtggagcgctatacagagttttatcatgtacccactcacagtgatgccagc
aagaagagactgattgaggatactgaagactggcgtccaaggactggaacaactcagtct
cgctctttccgaatccttgcccagatcactgggactgaacatttgaaagaatctgaagcc
gataatacaaagaaggcaaataactctcaggagccttctccgcagttggcttcctcggta
gcttccacacggagcatgcccgagagcctggacagcccaacctctggcagaccaggggtt
accagcctcacagctgcagctgccttcaagcctgtaggatccactggcgtcatcaagtca
ccaagctggcaacggccaaaccaaggagtaccttccactggaagaatctcaaacagcgct
acttactcaggatcagtggcaccagccaactcagctttgggacaaacccagccaagtgac
caggacactttagtgcaaagagctgagcacattccagcagggaaacgaactccgatgtgc
gcccattgtaaccaggtcatcagaggaccattcttagtggcactggggaaatcttggcac
ccagaagaattcaactgcgctcactgcaaaaatacaatggcctacattggatttgtagag
gagaaaggagccctgtattgtgagctgtgctatgagaaattctttgcccctgaatgtggt
cgatgccaaaggaagatccttggagaagtcatcagtgcgttgaaacaaacttggcatgtt
tcctgttttgtgtgtgtagcctgtggaaagcccattcggaacaatgtttttcacttggag
gatggtgaaccctactgtgagactgattattatgccctctttggtactatatgccatgga
tgtgaatttcccatagaagctggtgacatgttcctggaagctctgggctacacctggcat
gacacttgctttgtatgctcagtgtgttgtgaaagtttggaaggtcagacctttttctcc
aagaaggacaagcccctgtgtaagaaacatgctcattctgtgaatttttga

DBGET integrated database retrieval system