KEGG   Homo sapiens (human): 10618
Entry
10618             CDS       T01001                                 

Gene name
TGOLN2, TGN38, TGN46, TGN48, TGN51, TTGN2, hTGN46, hTGN48, hTGN51
Definition
(RefSeq) trans-golgi network protein 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: KCT2 UCR_TM
Other DBs
NCBI-GeneID: 10618
NCBI-ProteinID: NP_006455
OMIM: 603062
HGNC: 15450
Ensembl: ENSG00000152291
Vega: OTTHUMG00000153017
Pharos: O43493(Tbio)
UniProt: O43493
Position
2p11.2
AA seq 437 aa
MRFVVALVLLNVAAAGAVPLLATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEP
QTPKDSPSKSSAEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTK
DSTSKSHPELQTPKDSTGKSGAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPN
KSGADGQTPKDGSSKSGAEDQTPKDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGA
EEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGE
ETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSASSENREGTLS
DSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSK
VTRRPKASDYQRLDQKS
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgcggttcgtggttgccttggtcctcctgaacgtcgcagcggcgggagccgtgccgctc
ttggccaccgaaagcgtcaagcaagaagaagctggagtacggccttctgcaggaaacgtc
tccacccaccccagcttgagccaacggcctggaggctctaccaagtcgcatccggagccg
cagactccaaaagacagccctagcaagtcgagtgcggaggcgcagaccccagaagacacc
cccaacaagtcgggtgcggaggcaaagacccaaaaagacagctccaacaagtcgggtgcg
gaggcaaagacccaaaaaggcagcactagcaagtcgggttcggaggcgcagaccacaaaa
gacagcactagtaagtcgcatccggagctgcagactccaaaagacagcactggcaaatcg
ggtgcggaggcgcagaccccagaagacagccccaacaggtcgggtgcggaggcaaagacc
caaaaagacagccctagcaagtcaggttcggaggcgcagaccacaaaagatgtccctaat
aagtcgggtgcggacggccagaccccaaaagacggctccagcaagtcgggtgcggaggat
cagaccccaaaagacgtccctaacaagtcgggtgcggagaagcagactccaaaagacggc
tctaacaagtccggtgcagaggagcagggcccaatagacgggcccagcaagtcgggtgcg
gaggagcagacctcaaaagacagccctaacaaggtggttccagagcagccttcccggaaa
gaccattccaagcccatctccaacccttctgataacaaggagctccccaaggctgacaca
aaccagcttgctgacaaagggaagctttctcctcatgctttcaaaaccgaatctggggag
gaaactgacctcatttctcccccgcaggaggaagttaagtcttcagagcctactgaggat
gtggagcccaaagaggctgaagatgatgatacaggacccgaggagggctcaccgcccaaa
gaagagaaagaaaagatgtccggttctgcctccagtgagaaccgtgaagggacactttcg
gattccacgggtagcgagaaggatgacctttatccgaacggttctggaaatggcagcgcg
gagagcagccacttctttgcatatctggtgactgcagccattcttgtggctgtcctctat
atcgctcatcacaacaagcggaagatcattgcttttgtcctggaaggaaaaagatctaaa
gtcacccggcggccaaaggccagtgactaccaacgtttggaccagaagtcctaa

DBGET integrated database retrieval system