KEGG   Homo sapiens (human): 1062Help
Entry
1062              CDS       T01001                                 

Gene name
CENPE, CENP-E, KIF10, MCPH13, PPP1R61
Definition
(RefSeq) centromere protein E
  KO
K11498  centromeric protein E
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    1062 (CENPE)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1062 (CENPE)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     1062 (CENPE)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     1062 (CENPE)
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     1062 (CENPE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd
Motif
Other DBs
NCBI-GeneID: 1062
NCBI-ProteinID: NP_001804
OMIM: 117143
HGNC: 1856
Ensembl: ENSG00000138778
Vega: OTTHUMG00000160980
Pharos: Q02224(Tchem)
UniProt: Q02224
Structure
PDB: 

Position
4q24
AA seq 2701 aa AA seqDB search
MAEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTK
NVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKF
PDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALK
WITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSE
RAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNA
KTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRKEIMDLKKQLE
EVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKRR
VTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLS
EIEWNPATKLLNQENIESELNSLRADYDNLVLDYEQLRTEKEEMELKLKEKNDLDEFEAL
ERKTKKDQEMQLIHEISNLKNLVKHAEVYNQDLENELSSKVELLREKEDQIKKLQEYIDS
QKLENIKMDLSYSLESIEDPKQMKQTLFDAETVALDAKRESAFLRSENLELKEKMKELAT
TYKQMENDIQLYQSQLEAKKKMQVDLEKELQSAFNEITKLTSLIDGKVPKDLLCNLELEG
KITDLQKELNKEVEENEALREEVILLSELKSLPSEVERLRKEIQDKSEELHIITSEKDKL
FSEVVHKESRVQGLLEEIGKTKDDLATTQSNYKSTDQEFQNFKTLHMDFEQKYKMVLEEN
ERMNQEIVNLSKEAQKFDSSLGALKTELSYKTQELQEKTREVQERLNEMEQLKEQLENRD
STLQTVEREKTLITEKLQQTLEEVKTLTQEKDDLKQLQESLQIERDQLKSDIHDTVNMNI
DTQEQLRNALESLKQHQETINTLKSKISEEVSRNLHMEENTGETKDEFQQKMVGIDKKQD
LEAKNTQTLTADVKDNEIIEQQRKIFSLIQEKNELQQMLESVIAEKEQLKTDLKENIEMT
IENQEELRLLGDELKKQQEIVAQEKNHAIKKEGELSRTCDRLAEVEEKLKEKSQQLQEKQ
QQLLNVQEEMSEMQKKINEIENLKNELKNKELTLEHMETERLELAQKLNENYEEVKSITK
ERKVLKELQKSFETERDHLRGYIREIEATGLQTKEELKIAHIHLKEHQETIDELRRSVSE
KTAQIINTQDLEKSHTKLQEEIPVLHEEQELLPNVKEVSETQETMNELELLTEQSTTKDS
TTLARIEMERLRLNEKFQESQEEIKSLTKERDNLKTIKEALEVKHDQLKEHIRETLAKIQ
ESQSKQEQSLNMKEKDNETTKIVSEMEQFKPKDSALLRIEIEMLGLSKRLQESHDEMKSV
AKEKDDLQRLQEVLQSESDQLKENIKEIVAKHLETEEELKVAHCCLKEQEETINELRVNL
SEKETEISTIQKQLEAINDKLQNKIQEIYEKEEQFNIKQISEVQEKVNELKQFKEHRKAK
DSALQSIESKMLELTNRLQESQEEIQIMIKEKEEMKRVQEALQIERDQLKENTKEIVAKM
KESQEKEYQFLKMTAVNETQEKMCEIEHLKEQFETQKLNLENIETENIRLTQILHENLEE
MRSVTKERDDLRSVEETLKVERDQLKENLRETITRDLEKQEELKIVHMHLKEHQETIDKL
RGIVSEKTNEISNMQKDLEHSNDALKAQDLKIQEELRIAHMHLKEQQETIDKLRGIVSEK
TDKLSNMQKDLENSNAKLQEKIQELKANEHQLITLKKDVNETQKKVSEMEQLKKQIKDQS
LTLSKLEIENLNLAQKLHENLEEMKSVMKERDNLRRVEETLKLERDQLKESLQETKARDL
EIQQELKTARMLSKEHKETVDKLREKISEKTIQISDIQKDLDKSKDELQKKIQELQKKEL
QLLRVKEDVNMSHKKINEMEQLKKQFEAQNLSMQSVRMDNFQLTKKLHESLEEIRIVAKE
RDELRRIKESLKMERDQFIATLREMIARDRQNHQVKPEKRLLSDGQQHLTESLREKCSRI
KELLKRYSEMDDHYECLNRLSLDLEKEIEFQKELSMRVKANLSLPYLQTKHIEKLFTANQ
RCSMEFHRIMKKLKYVLSYVTKIKEEQHESINKFEMDFIDEVEKQKELLIKIQHLQQDCD
VPSRELRDLKLNQNMDLHIEEILKDFSESEFPSIKTEFQQVLSNRKEMTQFLEEWLNTRF
DIEKLKNGIQKENDRICQVNNFFNNRIIAIMNESTEFEERSATISKEWEQDLKSLKEKNE
KLFKNYQTLKTSLASGAQVNPTTQDNKNPHVTSRATQLTTEKIRELENSLHEAKESAMHK
ESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGAKPYKEEIEDL
KMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLRENLRRSQQAQDTSVISEHTD
PQPSNKPLTCGGGSGIVQNTKALILKSEHIRLEKEISKLKQQNEQLIKQKNELLSNNQHL
SNEVKTWKERTLKREAHKQVTCENSPKSPKVTGTASKKKQITPSQCKERNLQDPVPKESP
KSCFFDSRSKSLPSPHPVRYFDNSSLGLCPEVQNAGAESVDSQPGPWHASSGKDVPECKT
Q
NT seq 8106 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggaaggagccgtggccgtctgcgtgcgagtgcggccgctgaacagcagagaa
gaatcacttggagaaactgcccaagtttactggaaaactgacaataatgtcatttatcaa
gttgatggaagtaaatccttcaattttgatcgtgtctttcatggtaatgaaactaccaaa
aatgtgtatgaagaaatagcagcaccaatcatcgattctgccatacaaggctacaatggt
actatatttgcctatggacagactgcttcaggaaaaacatataccatgatgggttcagaa
gatcatttgggagttatacccagggcaattcatgacattttccaaaaaattaagaagttt
cctgatagggaatttctcttacgtgtatcttacatggaaatatacaatgaaaccattaca
gatttactctgtggcactcaaaaaatgaaacctttaattattcgagaagatgtcaatagg
aatgtgtatgttgctgatctcacagaagaagttgtatatacatcagaaatggctttgaaa
tggattacaaagggagaaaagagcaggcattatggagaaacaaaaatgaatcaaagaagc
agtcgttctcataccatctttaggatgattttggaaagcagagagaagggtgaaccttct
aattgtgaaggatctgttaaggtatcccatttgaatttggttgatcttgcaggcagtgaa
agagctgctcaaacaggcgctgcaggtgtgcggctcaaggaaggctgtaatataaatcga
agcttatttattttgggacaagtgatcaagaaacttagtgatggacaagttggtggtttc
ataaattatcgagatagcaagttaacacgaattctccagaattccttgggaggaaatgca
aagacacgtattatctgcacaattactccagtatcttttgatgaaacacttactgctctc
cagtttgccagtactgctaaatatatgaagaatactccttatgttaatgaggtatcaact
gatgaagctctcctgaaaaggtatagaaaagaaataatggatcttaaaaaacaattagag
gaggtttctttagagacgcgggctcaggcaatggaaaaagaccaattggcccaacttttg
gaagaaaaagatttgcttcagaaagtacagaatgagaaaattgaaaacttaacacggatg
ctggtgacctcttcttccctcacgttgcaacaggaattaaaggctaaaagaaaacgaaga
gttacttggtgccttggcaaaattaacaaaatgaagaactcaaactatgcagatcaattt
aatataccaacaaatataacaacaaaaacacataagctttctataaatttattacgagaa
attgatgaatctgtctgttcagagtctgatgttttcagtaacactcttgatacattaagt
gagatagaatggaatccagcaacaaagctactaaatcaggagaatatagaaagtgagttg
aactcacttcgtgctgactatgataatctggtattagactatgaacaactacgaacagaa
aaagaagaaatggaattgaaattaaaagaaaagaatgatttggatgaatttgaggctcta
gaaagaaaaactaaaaaagatcaagagatgcaactaattcatgaaatttcgaacttaaag
aatttagttaagcatgcagaagtatataatcaagatcttgagaatgaactcagttcaaaa
gtagagctgcttagagaaaaggaagaccagattaagaagctacaggaatacatagactct
caaaagctagaaaatataaaaatggacttgtcatactcattggaaagcattgaagaccca
aaacaaatgaagcagactctgtttgatgctgaaactgtagcccttgatgccaagagagaa
tcagcctttcttagaagtgaaaatctggagctgaaggagaaaatgaaagaacttgcaact
acatacaagcaaatggaaaatgatattcagttatatcaaagccagttggaggcaaaaaag
aaaatgcaagttgatctggagaaagaattacaatctgcttttaatgagataacaaaactc
acctcccttatagatggcaaagttccaaaagatttgctctgtaatttggaattggaagga
aagattactgatcttcagaaagaactaaataaagaagttgaagaaaatgaagctttgcgg
gaagaagtcattttgctttcagaattgaaatctttaccttctgaagtagaaaggctgagg
aaagagatacaagacaaatctgaagagctccatataataacatcagaaaaagataaattg
ttttctgaagtagttcataaggagagtagagttcaaggtttacttgaagaaattgggaaa
acaaaagatgacctagcaactacacagtcgaattataaaagcactgatcaagaattccaa
aatttcaaaacccttcatatggactttgagcaaaagtataagatggtccttgaggagaat
gagagaatgaatcaggaaatagttaatctctctaaagaagcccaaaaatttgattcgagt
ttgggtgctttgaagaccgagctttcttacaagacccaagaacttcaggagaaaacacgt
gaggttcaagaaagactaaatgagatggaacagctgaaggaacaattagaaaatagagat
tctacgctgcaaactgtagaaagggagaaaacactgattactgagaaactgcagcaaact
ttagaagaagtaaaaactttaactcaagaaaaagatgatctaaaacaactccaagaaagc
ttgcaaattgagagggaccaactcaaaagtgatattcacgatactgttaacatgaatata
gatactcaagaacaattacgaaatgctcttgagtctctgaaacaacatcaagaaacaatt
aatacactaaaatcgaaaatttctgaggaagtttccaggaatttgcatatggaggaaaat
acaggagaaactaaagatgaatttcagcaaaagatggttggcatagataaaaaacaggat
ttggaagctaaaaatacccaaacactaactgcagatgttaaggataatgagataattgag
caacaaaggaagatattttctttaatacaggagaaaaatgaactccaacaaatgttagag
agtgttatagcagaaaaggaacaattgaagactgacctaaaggaaaatattgaaatgacc
attgaaaaccaggaagaattaagacttcttggggatgaacttaaaaagcaacaagagata
gttgcacaagaaaagaaccatgccataaagaaagaaggagagctttctaggacctgtgac
agactggcagaagttgaagaaaaactaaaggaaaagagccagcaactccaagaaaaacag
caacaacttcttaatgtacaagaagagatgagtgagatgcagaaaaagattaatgaaata
gagaatttaaagaatgaattaaagaacaaagaattgacattggaacatatggaaacagag
aggcttgagttggctcagaaacttaatgaaaattatgaggaagtgaaatctataaccaaa
gaaagaaaagttctaaaggaattacagaagtcatttgaaacagagagagaccaccttaga
ggatatataagagaaattgaagctacaggcctacaaaccaaagaagaactaaaaattgct
catattcacctaaaagaacaccaagaaactattgatgaactaagaagaagcgtatctgag
aagacagctcaaataataaatactcaggacttagaaaaatcccataccaaattacaagaa
gagatcccagtgcttcatgaggaacaagagttactgcctaatgtgaaagaagtcagtgag
actcaggaaacaatgaatgaactggagttattaacagaacagtccacaaccaaggactca
acaacactggcaagaatagaaatggaaaggctcaggttgaatgaaaaatttcaagaaagt
caggaagagataaaatctctaaccaaggaaagagacaaccttaaaacgataaaagaagcc
cttgaagttaaacatgaccagctgaaagaacatattagagaaactttggctaaaatccag
gagtctcaaagcaaacaagaacagtccttaaatatgaaagaaaaagacaatgaaactacc
aaaatcgtgagtgagatggagcaattcaaacccaaagattcagcactactaaggatagaa
atagaaatgctcggattgtccaaaagacttcaagaaagtcatgatgaaatgaaatctgta
gctaaggagaaagatgacctacagaggctgcaagaagttcttcaatctgaaagtgaccag
ctcaaagaaaacataaaagaaattgtagctaaacacctggaaactgaagaggaacttaaa
gttgctcattgttgcctgaaagaacaagaggaaactattaatgagttaagagtgaatctt
tcagagaaggaaactgaaatatcaaccattcaaaagcagttagaagcaatcaatgataaa
ttacagaacaagatccaagagatttatgagaaagaggaacaatttaatataaaacaaatt
agtgaggttcaggaaaaagtgaatgaactgaaacaattcaaggagcatcgcaaagccaag
gattcagcactacaaagtatagaaagtaagatgctcgagttgaccaacagacttcaagaa
agtcaagaagaaatacaaattatgattaaggaaaaagaggaaatgaaaagagtacaggag
gcccttcagatagagagagaccaactgaaagaaaacactaaagaaattgtagctaaaatg
aaagaatctcaagaaaaagaatatcagtttcttaagatgacagctgtcaatgagactcag
gagaaaatgtgtgaaatagaacacttgaaggagcaatttgagacccagaagttaaacctg
gaaaacatagaaacggagaatataaggttgactcagatactacatgaaaaccttgaagaa
atgagatctgtaacaaaagaaagagatgaccttaggagtgtggaggagactctcaaagta
gagagagaccagctcaaggaaaaccttagagaaactataactagagacctagaaaaacaa
gaggagctaaaaattgttcacatgcatctgaaggagcaccaagaaactattgataaacta
agagggattgtttcagagaaaacaaatgaaatatcaaatatgcaaaaggacttagaacac
tcaaatgatgccttaaaagcacaggatctgaaaatacaagaggaactaagaattgctcac
atgcatctgaaagagcagcaggaaactattgacaaactcagaggaattgtttctgagaag
acagataaactatcaaatatgcaaaaagatttagaaaattcaaatgctaaattacaagaa
aagattcaagaacttaaggcaaatgaacatcaacttattacgttaaaaaaagatgtcaat
gagacacagaaaaaagtgtctgaaatggagcaactaaagaaacaaataaaagaccaaagc
ttaactctgagtaaattagaaatagagaatttaaatttggctcagaaacttcatgaaaac
cttgaagaaatgaaatctgtaatgaaagaaagagataatctaagaagagtagaggagaca
ctcaaactggagagagaccaactcaaggaaagcctgcaagaaaccaaagctagagatctg
gaaatacaacaggaactaaaaactgctcgtatgctatcaaaagaacacaaagaaactgtt
gataaacttagagaaaaaatttcagaaaagacaattcaaatttcagacattcaaaaggat
ttagataaatcaaaagatgaattacagaaaaagatccaagaacttcagaaaaaagaactt
caactgcttagagtgaaagaagatgtcaatatgagtcataaaaaaattaatgaaatggaa
cagttgaagaagcaatttgaggcccaaaacttatctatgcaaagtgtgagaatggataac
ttccagttgactaagaaacttcatgaaagccttgaagaaataagaattgtagctaaagaa
agagatgagctaaggaggataaaagaatctctcaaaatggaaagggaccaattcatagca
accttaagggaaatgatagctagagaccgacagaaccaccaagtaaaacctgaaaaaagg
ttactaagtgatggacaacagcaccttacggaaagcctgagagaaaagtgctctagaata
aaagagcttttgaagagatactcagagatggatgatcattatgagtgcttgaatagattg
tctcttgacttggagaaggaaattgaattccaaaaagagctttcaatgagagttaaagca
aacctctcacttccctatttacaaaccaaacacattgaaaaactttttactgcaaaccag
agatgctccatggaattccacagaatcatgaagaaactgaagtatgtgttaagctatgtt
acaaaaataaaagaagaacaacatgaatccatcaataaatttgaaatggattttattgat
gaagtggaaaagcaaaaggaattgctaattaaaatacagcaccttcaacaagattgtgat
gtaccatccagagaattaagggatctcaaattgaaccagaatatggatctacatattgag
gaaattctcaaagatttctcagaaagtgagttccctagcataaagactgaatttcaacaa
gtactaagtaataggaaagaaatgacacagtttttggaagagtggttaaatactcgtttt
gatatagaaaagcttaaaaatggcatccagaaagaaaatgataggatttgtcaagtgaat
aacttctttaataacagaataattgccataatgaatgaatcaacagagtttgaggaaaga
agtgctaccatatccaaagagtgggaacaggacctgaaatcactgaaagagaaaaatgaa
aaactatttaaaaactaccaaacattgaagacttccttggcatctggtgcccaggttaat
cctaccacacaagacaataagaatcctcatgttacatcaagagctacacagttaaccaca
gagaaaattcgagagctggaaaattcactgcatgaagctaaagaaagtgctatgcataag
gaaagcaagattataaagatgcagaaagaacttgaggtgactaatgacataatagcaaaa
cttcaagccaaagttcatgaatcaaataaatgccttgaaaaaacaaaagagacaattcaa
gtacttcaggacaaagttgctttaggagctaagccatataaagaagaaattgaagatctc
aaaatgaagcttgtgaaaatagacctagagaaaatgaaaaatgccaaagaatttgaaaag
gaaatcagtgctacaaaagccactgtagaatatcaaaaggaagttataaggctattgaga
gaaaatctcagaagaagtcaacaggcccaagatacctcagtgatatcagaacatactgat
cctcagccttcaaataaacccttaacttgtggaggtggcagcggcattgtacaaaacaca
aaagctcttattttgaaaagtgaacatataaggctagaaaaagaaatttctaagttaaag
cagcaaaatgaacagctaataaaacaaaagaatgaattgttaagcaataatcagcatctt
tccaatgaggtcaaaacttggaaggaaagaacccttaaaagagaggctcacaaacaagta
acttgtgagaattctccaaagtctcctaaagtgactggaacagcttctaaaaagaaacaa
attacaccctctcaatgcaaggaacggaatttacaagatcctgtgccaaaggaatcacca
aaatcttgtttttttgatagccgatcaaagtctttaccatcacctcatccagttcgctat
tttgataactcaagtttaggcctttgtccagaggtgcaaaatgcaggagcagagagtgtg
gattctcagccaggtccttggcacgcctcctcaggcaaggatgtgcctgagtgcaaaact
cagtag

DBGET integrated database retrieval system