KEGG   Homo sapiens (human): 10622Help
Entry
10622             CDS       T01001                                 

Gene name
POLR3G, RPC32, RPC7
Definition
(RefSeq) RNA polymerase III subunit G
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Module
hsa_M00181  RNA polymerase III, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    10622 (POLR3G)
   00240 Pyrimidine metabolism
    10622 (POLR3G)
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    10622 (POLR3G)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    10622 (POLR3G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10622 (POLR3G)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     10622 (POLR3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_3_Rpc31 SAPS DUF4820 BUD22 Vfa1
Motif
Other DBs
NCBI-GeneID: 10622
NCBI-ProteinID: NP_006458
OMIM: 617456
HGNC: 30075
Ensembl: ENSG00000113356
Vega: OTTHUMG00000162809
Pharos: O15318(Tbio)
UniProt: O15318 A0A024RAM1
Position
5q14.3
AA seq 223 aa AA seqDB search
MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLAL
KQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAG
PKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDD
DAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggctgggaataaaggaagaggacgtgctgcttatacctttaatattgaggctgttgga
tttagcaaaggtgaaaagttacctgatgtagtgttgaaaccacccccactatttcctgat
acagattataaaccagtgccactgaaaacaggagaaggtgaagaatatatgctggctttg
aaacaggagttgagagaaacaatgaaaagaatgccttattttattgaaacacctgaagaa
agacaagatattgaaaggtatagtaaaagatacatgaaggtatacaaggaagaatggata
ccagattggagaagacttccaagagagatgatgccaagaaataaatgtaaaaaagcaggc
ccaaaacccaaaaaggcaaaagacgcaggcaaaggcacaccactcactaatactgaagat
gtgttgaaaaaaatggaggaattggaaaaaagaggtgatggtgaaaaatcagatgaggaa
aatgaagagaaagaaggaagcaaagagaaaagtaaagaaggtgatgatgacgatgacgat
gatgccgcagaacaggaggaatatgatgaagaagagcaagaagaggaaaatgactacatt
aattcatactttgaagatggagatgattttggcgcagacagtgatgacaacatggatgag
gcaacctattag

DBGET integrated database retrieval system