KEGG   Homo sapiens (human): 10627Help
Entry
10627             CDS       T01001                                 

Gene name
MYL12A, HEL-S-24, MLC-2B, MLCB, MRCL3, MRLC3, MYL2B
Definition
(RefSeq) myosin light chain 12A
  KO
K12757  myosin regulatory light chain 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10627 (MYL12A)
   04530 Tight junction
    10627 (MYL12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10627 (MYL12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    10627 (MYL12A)
   04670 Leukocyte transendothelial migration
    10627 (MYL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10627 (MYL12A)
   04147 Exosome [BR:hsa04147]
    10627 (MYL12A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     10627 (MYL12A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   10627 (MYL12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF2666
Motif
Other DBs
NCBI-GeneID: 10627
NCBI-ProteinID: NP_001289976
HGNC: 16701
Ensembl: ENSG00000101608
Vega: OTTHUMG00000131509
Pharos: P19105(Tbio)
UniProt: P19105
Position
18p11.31
AA seq 171 aa AA seqDB search
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL
GKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED
YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaagaacaaagaccaagaccaagaagcgccctcagcgtgcaacatccaat
gtgtttgctatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatgatt
gatcagaacagagatggtttcatcgacaaggaagatttgcatgatatgcttgcttcattg
gggaagaatccaactgatgagtatctagatgccatgatgaatgaggctccaggccccatc
aatttcaccatgttcctcaccatgtttggtgagaagttaaatggcacagatcctgaagat
gtcatcagaaatgcctttgcttgctttgatgaagaagcaactggcaccatacaggaagat
tacttgagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggatgag
ctgtacagagaagcacctattgataaaaaggggaatttcaattacatcgagttcacacgc
atcctgaaacatggagccaaagacaaagatgactga

DBGET integrated database retrieval system