KEGG   Homo sapiens (human): 10628Help
Entry
10628             CDS       T01001                                 

Gene name
TXNIP, ARRDC6, EST01027, HHCPA78, THIF, VDUP1
Definition
(RefSeq) thioredoxin interacting protein
  KO
K20910  thioredoxin-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    10628 (TXNIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C Vps26
Motif
Other DBs
NCBI-GeneID: 10628
NCBI-ProteinID: NP_006463
OMIM: 606599
HGNC: 16952
Ensembl: ENSG00000265972
Vega: OTTHUMG00000013755
Pharos: Q9H3M7(Tbio)
UniProt: Q9H3M7 A0A024R4B7
Structure
PDB: 

Position
1q21.1
AA seq 391 aa AA seqDB search
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGS
QQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGC
VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSV
SARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGN
HIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRS
GLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQD
SPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgttcaagaagatcaagtcttttgaggtggtctttaacgaccctgaaaaggtg
tacggcagtggcgagaaggtggctggccgggtgatagtggaggtgtgtgaagttactcgt
gtcaaagccgttaggatcctggcttgcggagtggctaaagtgctttggatgcagggatcc
cagcagtgcaaacagacttcggagtacctgcgctatgaagacacgcttcttctggaagac
cagccaacaggtgagaatgagatggtgatcatgagacctggaaacaaatatgagtacaag
ttcggctttgagcttcctcaggggcctctgggaacatccttcaaaggaaaatatgggtgt
gtagactactgggtgaaggcttttcttgaccgcccgagccagccaactcaagagacaaag
aaaaactttgaagtagtggatctggtggatgtcaatacccctgatttaatggcacctgtg
tctgctaaaaaagaaaagaaagtttcctgcatgttcattcctgatgggcgggtgtctgtc
tctgctcgaattgacagaaaaggattctgtgaaggtgatgagatttccatccatgctgac
tttgagaatacatgttcccgaattgtggtccccaaagctgccattgtggcccgccacact
taccttgccaatggccagaccaaggtgctgactcagaagttgtcatcagtcagaggcaat
catattatctcagggacatgcgcatcatggcgtggcaagagccttcgggttcagaagatc
aggccttctatcctgggctgcaacatccttcgagttgaatattccttactgatctatgtt
agcgttcctggatccaagaaggtcatccttgacctgcccctggtaattggcagcagatca
ggtctaagcagcagaacatccagcatggccagccgaaccagctctgagatgagttgggta
gatctgaacatccctgataccccagaagctcctccctgctatatggatgtcattcctgaa
gatcaccgattggagagcccaaccactcctctgctagatgacatggatggctctcaagac
agccctatctttatgtatgcccctgagttcaagttcatgccaccaccgacttatactgag
gtggatccctgcatcctcaacaacaatgtgcagtga

DBGET integrated database retrieval system