KEGG   Homo sapiens (human): 1063Help
Entry
1063              CDS       T01001                                 

Gene name
CENPF, CENF, CILD31, PRO1779, STROMS, hcp-1
Definition
(RefSeq) centromere protein F
  KO
K11499  centromere protein F
Organism
hsa  Homo sapiens (human)
Disease
H01814  Stromme syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1063 (CENPF)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     1063 (CENPF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-F_N CENP-F_leu_zip CENP-F_C_Rb_bdg Lectin_N Tissue_fac
Motif
Other DBs
NCBI-GeneID: 1063
NCBI-ProteinID: NP_057427
OMIM: 600236
HGNC: 1857
Ensembl: ENSG00000117724
Vega: OTTHUMG00000036955
Pharos: P49454(Tbio)
UniProt: P49454
Position
1q41
AA seq 3114 aa AA seqDB search
MSWALEEWKEGLPTRALQKIQELEGQLDKLKKEKQQRQFQLDSLEAALQKQKQKVENEKT
EGTNLKRENQRLMEICESLEKTKQKISHELQVKESQVNFQEGQLNSGKKQIEKLEQELKR
CKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEERKR
LEAEVKALQAKKASQTLPQATMNHRDIARHQASSSVFSWQQEKTPSHLSSNSQRTPIRRD
FSASYFSGEQEVTPSRSTLQIGKRDANSSFFDNSSSPHLLDQLKAQNQELRNKINELELR
LQGHEKEMKGQVNKFQELQLQLEKAKVELIEKEKVLNKCRDELVRTTAQYDQASTKYTAL
EQKLKKLTEDLSCQRQNAESARCSLEQKIKEKEKEFQEELSRQQRSFQTLDQECIQMKAR
LTQELQQAKNMHNVLQAELDKLTSVKQQLENNLEEFKQKLCRAEQAFQASQIKENELRRS
MEEMKKENNLLKSHSEQKAREVCHLEAELKNIKQCLNQSQNFAEEMKAKNTSQETMLRDL
QEKINQQENSLTLEKLKLAVADLEKQRDCSQDLLKKREHHIEQLNDKLSKTEKESKALLS
ALELKKKEYEELKEEKTLFSCWKSENEKLLTQMESEKENLQSKINHLETCLKTQQIKSHE
YNERVRTLEMDRENLSVEIRNLHNVLDSKSVEVETQKLAYMELQQKAEFSDQKHQKEIEN
MCLKTSQLTGQVEDLEHKLQLLSNEIMDKDRCYQDLHAEYESLRDLLKSKDASLVTNEDH
QRSLLAFDQQPAMHHSFANIIGEQGSMPSERSECRLEADQSPKNSAILQNRVDSLEFSLE
SQKQMNSDLQKQCEELVQIKGEIEENLMKAEQMHQSFVAETSQRISKLQEDTSAHQNVVA
ETLSALENKEKELQLLNDKVETEQAEIQELKKSNHLLEDSLKELQLLSETLSLEKKEMSS
IISLNKREIEELTQENGTLKEINASLNQEKMNLIQKSESFANYIDEREKSISELSDQYKQ
EKLILLQRCEETGNAYEDLSQKYKAAQEKNSKLECLLNECTSLCENRKNELEQLKEAFAK
EHQEFLTKLAFAEERNQNLMLELETVQQALRSEMTDNQNNSKSEAGGLKQEIMTLKEEQN
KMQKEVNDLLQENEQLMKVMKTKHECQNLESEPIRNSVKERESERNQCNFKPQMDLEVKE
ISLDSYNAQLVQLEAMLRNKELKLQESEKEKECLQHELQTIRGDLETSNLQDMQSQEISG
LKDCEIDAEEKYISGPHELSTSQNDNAHLQCSLQTTMNKLNELEKICEILQAEKYELVTE
LNDSRSECITATRKMAEEVGKLLNEVKILNDDSGLLHGELVEDIPGGEFGEQPNEQHPVS
LAPLDESNSYEHLTLSDKEVQMHFAELQEKFLSLQSEHKILHDQHCQMSSKMSELQTYVD
SLKAENLVLSTNLRNFQGDLVKEMQLGLEEGLVPSLSSSCVPDSSSLSSLGDSSFYRALL
EQTGDMSLLSNLEGAVSANQCSVDEVFCSSLQEENLTRKETPSAPAKGVEELESLCEVYR
QSLEKLEEKMESQGIMKNKEIQELEQLLSSERQELDCLRKQYLSENEQWQQKLTSVTLEM
ESKLAAEKKQTEQLSLELEVARLQLQGLDLSSRSLLGIDTEDAIQGRNESCDISKEHTSE
TTERTPKHDVHQICDKDAQQDLNLDIEKITETGAVKPTGECSGEQSPDTNYEPPGEDKTQ
GSSECISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESL
LNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQELLQRV
ETSEGLNSDLEMHADKSSREDIGDNVAKVNDSWKERFLDVENELSRIRSEKASIEHEALY
LEADLEVVQTEKLCLEKDNENKQKVIVCLEEELSVVTSERNQLRGELDTMSKKTTALDQL
SEKMKEKTQELESHQSECLHCIQVAEAEVKEKTELLQTLSSDVSELLKDKTHLQEKLQSL
EKDSQALSLTKCELENQIAQLNKEKELLVKESESLQARLSESDYEKLNVSKALEAALVEK
GEFALRLSSTQEEVHQLRRGIEKLRVRIEADEKKQLHIAEKLKERERENDSLKDKVENLE
RELQMSEENQELVILDAENSKAEVETLKTQIEEMARSLKVFELDLVTLRSEKENLTKQIQ
EKQGQLSELDKLLSSFKSLLEEKEQAEIQIKEESKTAVEMLQNQLKELNEAVAALCGDQE
IMKATEQSLDPPIEEEHQLRNSIEKLRARLEADEKKQLCVLQQLKESEHHADLLKGRVEN
LERELEIARTNQEHAALEAENSKGEVETLKAKIEGMTQSLRGLELDVVTIRSEKENLTNE
LQKEQERISELEIINSSFENILQEKEQEKVQMKEKSSTAMEMLQTQLKELNERVAALHND
QEACKAKEQNLSSQVECLELEKAQLLQGLDEAKNNYIVLQSSVNGLIQEVEDGKQKLEKK
DEEISRLKNQIQDQEQLVSKLSQVEGEHQLWKEQNLELRNLTVELEQKIQVLQSKNASLQ
DTLEVLQSSYKNLENELELTKMDKMSFVEKVNKMTAKETELQREMHEMAQKTAELQEELS
GEKNRLAGELQLLLEEIKSSKDQLKELTLENSELKKSLDCMHKDQVEKEGKVREEIAEYQ
LRLHEAEKKHQALLLDTNKQYEVEIQTYREKLTSKEECLSSQKLEIDLLKSSKEELNNSL
KATTQILEELKKTKMDNLKYVNQLKKENERAQGKMKLLIKSCKQLEEEKEILQKELSQLQ
AAQEKQKTGTVMDTKVDELTTEIKELKETLEEKTKEADEYLDKYCSLLISHEKLEKAKEM
LETQVAHLCSQQSKQDSRGSPLLGPVVPGPSPIPSVTEKRLSSGQNKASGKRQRSSGIWE
NGRGPTPATPESFSKKSKKAVMSGIHPAEDTEGTEFEPEGLPEVVKKGFADIPTGKTSPY
ILRRTTMATRTSPRLAAQKLALSPLSLGKENLAESSKPTAGGSRSQKVKVAQRSPVDSGT
ILREPTTKSVPVNNLPERSPTDSPREGLRVKRGRLVPSPKAGLESNGSENCKVQ
NT seq 9345 nt NT seq  +upstreamnt  +downstreamnt
atgagctgggctttggaagaatggaaagaagggctgcctacaagagctcttcagaaaatt
caagagcttgaaggacagcttgacaaactgaagaaggaaaagcagcaaaggcagtttcag
cttgacagtctcgaggctgcgctgcagaagcaaaaacagaaggttgaaaatgaaaaaacc
gagggtacaaacctgaaaagggagaatcaaagattgatggaaatatgtgaaagtctggag
aaaactaagcagaagatttctcatgaacttcaagtcaaggagtcacaagtgaatttccag
gaaggacaactgaattcaggcaaaaaacaaatagaaaaactggaacaggaacttaaaagg
tgtaaatctgagcttgaaagaagccaacaagctgcgcagtctgcagatgtctctctgaat
ccatgcaatacaccacaaaaaatttttacaactccactaacaccaagtcaatattatagt
ggttccaagtatgaagatctaaaagaaaaatataataaagaggttgaagaacgaaaaaga
ttagaggcagaggttaaagccttgcaggctaaaaaagcaagccagactcttccacaagcc
accatgaatcaccgcgacattgcccggcatcaggcttcatcatctgtgttctcatggcag
caagagaagaccccaagtcatctttcatctaattctcaaagaactccaattaggagagat
ttctctgcatcttacttttctggggaacaagaggtgactccaagtcgatcaactttgcaa
atagggaaaagagatgctaatagcagtttctttgacaattctagcagtcctcatcttttg
gatcaattaaaagcgcagaatcaagagctaagaaacaagattaatgagttggaactacgc
ctgcaaggacatgaaaaagaaatgaaaggccaagtgaataagtttcaagaactccaactc
caactggagaaagcaaaagtggaattaattgaaaaagagaaagttttgaacaaatgtagg
gatgaactagtgagaacaacagcacaatacgaccaggcgtcaaccaagtatactgcattg
gaacaaaaactgaaaaaattgacggaagatttgagttgtcagcgacaaaatgcagaaagt
gccagatgttctctggaacagaaaattaaggaaaaagaaaaggagtttcaagaggagctc
tcccgtcaacagcgttctttccaaacactggaccaggagtgcatccagatgaaggccaga
ctcacccaggagttacagcaagccaagaatatgcacaacgtcctgcaggctgaactggat
aaactcacatcagtaaagcaacagctagaaaacaatttggaagagtttaagcaaaagttg
tgcagagctgaacaggcgttccaggcgagtcagatcaaggagaatgagctgaggagaagc
atggaggaaatgaagaaggaaaacaacctccttaagagtcactctgagcaaaaggccaga
gaagtctgccacctggaggcagaactcaagaacatcaaacagtgtttaaatcagagccag
aattttgcagaagaaatgaaagcgaagaatacctctcaggaaaccatgttaagagatctt
caagaaaaaataaatcagcaagaaaactccttgactttagaaaaactgaagcttgctgtg
gctgatctggaaaagcagcgagattgttctcaagaccttttgaagaaaagagaacatcac
attgaacaacttaatgataagttaagcaagacagagaaagagtccaaagccttgctgagt
gctttagagttaaaaaagaaagaatatgaagaattgaaagaagagaaaactctgttttct
tgttggaaaagtgaaaacgaaaaacttttaactcagatggaatcagaaaaggaaaacttg
cagagtaaaattaatcacttggaaacttgtctgaagacacagcaaataaaaagtcatgaa
tacaacgagagagtaagaacgctggagatggacagagaaaacctaagtgtcgagatcaga
aaccttcacaacgtgttagacagtaagtcagtggaggtagagacccagaaactagcttat
atggagctacagcagaaagctgagttctcagatcagaaacatcagaaggaaatagaaaat
atgtgtttgaagacttctcagcttactgggcaagttgaagatctagaacacaagcttcag
ttactgtcaaatgaaataatggacaaagaccggtgttaccaagacttgcatgccgaatat
gagagcctcagggatctgctaaaatccaaagatgcttctctggtgacaaatgaagatcat
cagagaagtcttttggcttttgatcagcagcctgccatgcatcattcctttgcaaatata
attggagaacaaggaagcatgccttcagagaggagtgaatgtcgtttagaagcagaccaa
agtccgaaaaattctgccatcctacaaaatagagttgattcacttgaattttcattagag
tctcaaaaacagatgaactcagacctgcaaaagcagtgtgaagagttggtgcaaatcaaa
ggagaaatagaagaaaatctcatgaaagcagaacagatgcatcaaagttttgtggctgaa
acaagtcagcgcattagtaagttacaggaagacacttctgctcaccagaatgttgttgct
gaaaccttaagtgcccttgagaacaaggaaaaagagctgcaacttttaaatgataaggta
gaaactgagcaggcagagattcaagaattaaaaaagagcaaccatctacttgaagactct
ctaaaggagctacaacttttatccgaaaccctaagcttggagaagaaagaaatgagttcc
atcatttctctaaataaaagggaaattgaagagctgacccaagagaatgggactcttaag
gaaattaatgcatccttaaatcaagagaagatgaacttaatccagaaaagtgagagtttt
gcaaactatatagatgaaagggagaaaagcatttcagagttatctgatcagtacaagcaa
gaaaaacttattttactacaaagatgtgaagaaaccggaaatgcatatgaggatcttagt
caaaaatacaaagcagcacaggaaaagaattctaaattagaatgcttgctaaatgaatgc
actagtctttgtgaaaataggaaaaatgagttggaacagctaaaggaagcatttgcaaag
gaacaccaagaattcttaacaaaattagcatttgctgaagaaagaaatcagaatctgatg
ctagagttggagacagtgcagcaagctctgagatctgagatgacagataaccaaaacaat
tctaagagcgaggctggtggtttaaagcaagaaatcatgactttaaaggaagaacaaaac
aaaatgcaaaaggaagttaatgacttattacaagagaatgaacagctgatgaaggtaatg
aagactaaacatgaatgtcaaaatctagaatcagaaccaattaggaactctgtgaaagaa
agagagagtgagagaaatcaatgtaattttaaacctcagatggatcttgaagttaaagaa
atttctctagatagttataatgcgcagttggtgcaattagaagctatgctaagaaataag
gaattaaaacttcaggaaagtgagaaggagaaggagtgcctgcagcatgaattacagaca
attagaggagatcttgaaaccagcaatttgcaagacatgcagtcacaagaaattagtggc
cttaaagactgtgaaatagatgcggaagaaaagtatatttcagggcctcatgagttgtca
acaagtcaaaacgacaatgcacaccttcagtgctctctgcaaacaacaatgaacaagctg
aatgagctagagaaaatatgtgaaatactgcaggctgaaaagtatgaactcgtaactgag
ctgaatgattcaaggtcagaatgtatcacagcaactaggaaaatggcagaagaggtaggg
aaactactaaatgaagttaaaatattaaatgatgacagtggtcttctccatggtgagtta
gtggaagacataccaggaggtgaatttggtgaacaaccaaatgaacagcaccctgtgtct
ttggctccattggacgagagtaattcctacgagcacttgacattgtcagacaaagaagtt
caaatgcactttgccgaattgcaagagaaattcttatctttacaaagtgaacacaaaatt
ttacatgatcagcactgtcagatgagctctaaaatgtcagagctgcagacctatgttgac
tcattaaaggccgaaaatttggtcttgtcaacgaatctgagaaactttcaaggtgacttg
gtgaaggagatgcagctgggcttggaggaggggctcgttccatccctgtcatcctcttgt
gtgcctgacagctctagtcttagcagtttgggagactcctccttttacagagctctttta
gaacagacaggagatatgtctcttttgagtaatttagaaggggctgtttcagcaaaccag
tgcagtgtagatgaagtattttgcagcagtctgcaggaggagaatctgaccaggaaagaa
accccttcggccccagcgaagggtgttgaagagcttgagtccctctgtgaggtgtaccgg
cagtccctcgagaagctagaagagaaaatggaaagtcaagggattatgaaaaataaggaa
attcaagagctcgagcagttattaagttctgaaaggcaagagcttgactgccttaggaag
cagtatttgtcagaaaatgaacagtggcaacagaagctgacaagcgtgactctggagatg
gagtccaagttggcggcagaaaagaaacagacggaacaactgtcacttgagctggaagta
gcacgactccagctacaaggtctggacttaagttctcggtctttgcttggcatcgacaca
gaagatgctattcaaggccgaaatgagagctgtgacatatcaaaagaacatacttcagaa
actacagaaagaacaccaaagcatgatgttcatcagatttgtgataaagatgctcagcag
gacctcaatctagacattgagaaaataactgagactggtgcagtgaaacccacaggagag
tgctctggggaacagtccccagataccaattatgagcctccaggggaagataaaacccag
ggctcttcagaatgcatttctgaattgtcattttctggtcctaatgctttggtacctatg
gatttcctggggaatcaggaagatatccataatcttcaactgcgggtaaaagagacatca
aatgagaatttgagattacttcatgtgatagaggaccgtgacagaaaagttgaaagtttg
ctaaatgaaatgaaagaattagactcaaaactccatttacaggaggtacaactaatgacc
aaaattgaagcatgcatagaattggaaaaaatagttggggaacttaagaaagaaaactca
gatttaagtgaaaaattggaatatttttcttgtgatcaccaggagttactccagagagta
gaaacttctgaaggcctcaattctgatttagaaatgcatgcagataaatcatcacgtgaa
gatattggagataatgtggccaaggtgaatgacagctggaaggagagatttcttgatgtg
gaaaatgagctgagtaggatcagatcggagaaagctagcattgagcatgaagccctctac
ctggaggctgacttagaggtagttcaaacagagaagctatgtttagaaaaagacaatgaa
aataagcagaaggttattgtctgccttgaagaagaactctcagtggtcacaagtgagaga
aaccagcttcgtggagaattagatactatgtcaaaaaaaaccacggcactggatcagttg
tctgaaaaaatgaaggagaaaacacaagagcttgagtctcatcaaagtgagtgtctccat
tgcattcaggtggcagaggcagaggtgaaggaaaagacggaactccttcagactttgtcc
tctgatgtgagtgagctgttaaaagacaaaactcatctccaggaaaagctgcagagtttg
gaaaaggactcacaggcactgtctttgacaaaatgtgagctggaaaaccaaattgcacaa
ctgaataaagagaaagaattgcttgtcaaggaatctgaaagcctgcaggccagactgagt
gaatcagattatgaaaagctgaatgtctccaaggccttggaggccgcactggtggagaaa
ggtgagttcgcattgaggctgagctcaacacaggaggaagtgcatcagctgagaagaggc
atcgagaaactgagagttcgcattgaggccgatgaaaagaagcagctgcacatcgcagag
aaactgaaagaacgcgagcgggagaatgattcacttaaggataaagttgagaaccttgaa
agggaattgcagatgtcagaagaaaaccaggagctagtgattcttgatgccgagaattcc
aaagcagaagtagagactctaaaaacacaaatagaagagatggccagaagcctgaaagtt
tttgaattagaccttgtcacgttaaggtctgaaaaagaaaatctgacaaaacaaatacaa
gaaaaacaaggtcagttgtcagaactagacaagttactctcttcatttaaaagtctgtta
gaagaaaaggagcaagcagagatacagatcaaagaagaatctaaaactgcagtggagatg
cttcagaatcagttaaaggagctaaatgaggcagtagcagccttgtgtggtgaccaagaa
attatgaaggccacagaacagagtctagacccaccaatagaggaagagcatcagctgaga
aatagcattgaaaagctgagagcccgcctagaagctgatgaaaagaagcagctctgtgtc
ttacaacaactgaaggaaagtgagcatcatgcagatttacttaagggtagagtggagaac
cttgaaagagagctagagatagccaggacaaaccaagagcatgcagctcttgaggcagag
aattccaaaggagaggtagagaccctaaaagcaaaaatagaagggatgacccaaagtctg
agaggtctggaattagatgttgttactataaggtcagaaaaagaaaatctgacaaatgaa
ttacaaaaagagcaagagcgaatatctgaattagaaataataaattcatcatttgaaaat
attttgcaagaaaaagagcaagagaaagtacagatgaaagaaaaatcaagcactgccatg
gagatgcttcaaacacaattaaaagagctcaatgagagagtggcagccctgcataatgac
caagaagcctgtaaggccaaagagcagaatcttagtagtcaagtagagtgtcttgaactt
gagaaggctcagttgctacaaggccttgatgaggccaaaaataattatattgttttgcaa
tcttcagtgaatggcctcattcaagaagtagaagatggcaagcagaaactggagaagaag
gatgaagaaatcagtagactgaaaaatcaaattcaagaccaagagcagcttgtctctaaa
ctgtcccaggtggaaggagagcaccaactttggaaggagcaaaacttagaactgagaaat
ctgacagtggaattggagcagaagatccaagtgctacaatccaaaaatgcctctttgcag
gacacattagaagtgctgcagagttcttacaagaatctagagaatgagcttgaattgaca
aaaatggacaaaatgtcctttgttgaaaaagtaaacaaaatgactgcaaaggaaactgag
ctgcagagggaaatgcatgagatggcacagaaaacagcagagctgcaagaagaactcagt
ggagagaaaaataggctagctggagagttgcagttactgttggaagaaataaagagcagc
aaagatcaattgaaggagctcacactagaaaatagtgaattgaagaagagcctagattgc
atgcacaaagaccaggtggaaaaggaagggaaagtgagagaggaaatagctgaatatcag
ctacggcttcatgaagctgaaaagaaacaccaggctttgcttttggacacaaacaaacag
tatgaagtagaaatccagacataccgagagaaattgacttctaaagaagaatgtctcagt
tcacagaagctggagatagaccttttaaagtctagtaaagaagagctcaataattcattg
aaagctactactcagattttggaagaattgaagaaaaccaagatggacaatctaaaatat
gtaaatcagttgaagaaggaaaatgaacgtgcccaggggaaaatgaagttgttgatcaaa
tcctgtaaacagctggaagaggaaaaggagatactgcagaaagaactctctcaacttcaa
gctgcacaggagaagcagaaaacaggtactgttatggataccaaggtcgatgaattaaca
actgagatcaaagaactgaaagaaactcttgaagaaaaaaccaaggaggcagatgaatac
ttggataagtactgttccttgcttataagccatgaaaagttagagaaagctaaagagatg
ttagagacacaagtggcccatctgtgttcacagcaatctaaacaagattcccgagggtct
cctttgctaggtccagttgttccaggaccatctccaatcccttctgttactgaaaagagg
ttatcatctggccaaaataaagcttcaggcaagaggcaaagatccagtggaatatgggag
aatggtagaggaccaacacctgctaccccagagagcttttctaaaaaaagcaagaaagca
gtcatgagtggtattcaccctgcagaagacacggaaggtactgagtttgagccagaggga
cttccagaagttgtaaagaaagggtttgctgacatcccgacaggaaagactagcccatat
atcctgcgaagaacaaccatggcaactcggaccagcccccgcctggctgcacagaagtta
gcgctatccccactgagtctcggcaaagaaaatcttgcagagtcctccaaaccaacagct
ggtggcagcagatcacaaaaggtcaaagttgctcagcggagcccagtagattcaggcacc
atcctccgagaacccaccacgaaatccgtcccagtcaataatcttcctgagagaagtccg
actgacagccccagagagggcctgagggtcaagcgaggccgacttgtccccagccccaaa
gctggactggagtccaacggcagtgagaactgtaaggtccagtga

DBGET integrated database retrieval system