KEGG   Homo sapiens (human): 10630Help
Entry
10630             CDS       T01001                                 

Gene name
PDPN, AGGRUS, GP36, GP40, Gp38, HT1A-1, OTS8, PA2.26, T1A, T1A-2, T1A2, TI1A
Definition
(RefSeq) podoplanin
  KO
K16778  podoplanin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10630 (PDPN)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    10630 (PDPN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Podoplanin DUF4690 DUF4064 DUF2970 DUF5305 Peptidase_M56 Sugar_tr Glycophorin_A DUF2407_C
Motif
Other DBs
NCBI-GeneID: 10630
NCBI-ProteinID: NP_001006625
OMIM: 608863
HGNC: 29602
Ensembl: ENSG00000162493
Vega: OTTHUMG00000007912
Pharos: Q86YL7(Tbio)
UniProt: Q86YL7
Position
1p36.21
AA seq 120 aa AA seqDB search
MPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATAS
NVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtgccgaagatgatgtggtgactccaggaaccagcgaagaccgctataagtct
ggcttgacaactctggtggcaacaagtgtcaacagtgtaacaggcattcgcatcgaggat
ctgccaacttcagaaagcacagtccacgcgcaagaacaaagtccaagcgccacagcctca
aacgtggccaccagtcactccacggagaaagtggatggagacacacagacaacagttgag
aaagatggtttgtcaacagtgaccctggttggaatcatagttggggtcttactagccatc
ggcttcattggtgcaatcatcgttgtggttatgcgaaaaatgtcgggaaggtactcgccc
taa

DBGET integrated database retrieval system