KEGG   Homo sapiens (human): 10632Help
Entry
10632             CDS       T01001                                 

Gene name
ATP5MG, ATP5JG, ATP5L
Definition
(RefSeq) ATP synthase membrane subunit g
  KO
K02140  F-type H+-transporting ATPase subunit g
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    10632 (ATP5MG)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    10632 (ATP5MG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_G
Motif
Other DBs
NCBI-GeneID: 10632
NCBI-ProteinID: NP_006467
OMIM: 617473
HGNC: 14247
Ensembl: ENSG00000167283
Vega: OTTHUMG00000166336
Pharos: O75964(Tdark)
UniProt: O75964
Position
11q23.3
AA seq 103 aa AA seqDB search
MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSA
QTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggcccaatttgtccgtaaccttgtggagaagaccccggcgctggtgaacgctgctgtg
acttactcgaagcctcgattggccacattttggtactacgccaaggttgagctggttcct
cccacccctgctgagatccctagagctattcagagcctgaaaaaaatagtcaatagtgct
cagactggtagcttcaaacagctcacagttaaggaagctgtgctgaatggtttggtggcc
actgaggtgttgatgtggttttatgtcggagagattataggcaagcggggcatcattggc
tatgatgtttga

DBGET integrated database retrieval system