KEGG   Homo sapiens (human): 10634Help
Entry
10634             CDS       T01001                                 

Gene name
GAS2L1, GAR22
Definition
(RefSeq) growth arrest specific 2 like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GAS2 CH
Motif
Other DBs
NCBI-GeneID: 10634
NCBI-ProteinID: NP_006469
OMIM: 602128
HGNC: 16955
Ensembl: ENSG00000185340
Vega: OTTHUMG00000151108
Pharos: Q99501(Tbio)
UniProt: Q99501 A0A5E8
Position
22q12.2
AA seq 681 aa AA seqDB search
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGT
TLCQHANAVTEAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAA
GEDTTETAPAPGTPARGPRMTPSDLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTAHRPPQPRVCTFSPQRVSPTT
SPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPRPRDQLPPHPRSRRYSGDSDSSAS
SAQSGPLGTRSDDTGTGPRRERPSRRLTTGTPASPRRPPALRSQSRDRLDRGRPRGAPGG
RGAQLSVPSPARRARSQSREEQAVLLVRRDRDGQHSWVPRGRGSGGSGRSTPQTPRARSP
AAPRLSRVSSPSPELGTTPASIFRTPLQLDPQQEQQLFRRLEEEFLANARALEAVASVTP
TGPAPDPARAPDPPAPDSAYCSSSSSSSSLSVLGGKCGQPGDSGRTANGLPGPRSQALSS
SSDEGSPCPGMGGPLDAPGSPLACTEPSRTWARGRMDTQPDRKPSRIPTPRGPRRPSGPA
ELGTWHALHSVTPRAEPDSWM
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcagacccagtggcgggcatcgcgggctcggcggccaagagcgtgcggccatttcgc
tccagtgaggcctacgtggaggccatgaaggaggacctggccgagtggctcaatgccttg
tacggcctgggtctcccgggtggtggcgatggcttcctgacagggctggccacgggcacg
accctgtgccaacatgccaacgccgtgaccgaggctgcccgtgcattggcagccgcccgc
ccggcccgaggtgtggccttccaggcgcacagtgtagtgcctggctccttcatggcgcgc
gacaacgtggccaccttcatcggctggtgccgcgtggagctgggtgtgccggaggtgctc
atgtttgagactgaggacctggtgctgcgcaagaacgagaagagcgtggtgctgtgcctg
ctggaggtggcgcggcgtggggcacgcctgggcctgctggccccacgcctcgtgcagttt
gagcaggagattgagcgggagctgcgtgctgcacccccagcccccaacgcccctgccgct
ggggaggacaccactgaaaccgcccccgcaccagggactcctgcccgcggcccccgcatg
acacccagcgacctgcgcaacctcgacgagctggtgagggagattctgggccgctgcacc
tgccctgaccagtttcccatgatcaaggtctcagaggggaagtaccgtgtgggggactcg
agcctgctcatctttgtgcgggtgctgaggagccacgtgatggtgcgagtgggtggtggc
tgggacacgctggagcattacctggacaagcacgacccgtgccgctgctcctccactgct
catcgcccaccccagccgagggtctgcaccttttctccacagagggtgtcgcccaccacc
agtccccgccctgctagcccagtccctgggagtgagcgccggggctcccggcctgagatg
actcccgttagcttacgaagcacaaaggaggggcccgagaccccacccaggccccgggat
cagctgcccccccatccccgctcccgccgctactccggggacagtgactcctcagcctcc
tccgcccagagcggcccccttggtacccgcagtgatgacacaggcactggcccccggagg
gagcgacccagccggcggctgaccacaggcaccccggcctctccgagacggcctcctgcc
ctgcgcagccagtcccgagaccggctggatcgcggccggccccggggggccccaggaggc
aggggagcccagctgtcggtccccagccctgcccggcgggcccggagccagagccgcgag
gagcaggctgtgctgcttgtgcgcagggatcgagacgggcagcactcatgggtgccaagg
ggcaggggcagtgggggctcgggcaggagcaccccccagactccccgtgcccgcagccct
gcagcaccccggctttcccgggtctccagccccagtccagagttgggcaccacaccggcc
agcatcttccgcacacccctgcagctcgacccgcagcaggagcagcagctgttccggcgc
ctggaagaggagttcctggccaatgcccgggcccttgaggctgttgctagcgtgaccccc
actggaccagcccctgacccagctcgggcccccgaccctccagctcctgactctgcctat
tgttcctccagttcctcctcttcgtccctcagcgtcctgggtggcaaatgtggccaacct
ggggactctggccggacggccaatgggctgcctgggccccgaagccaagccctttccagc
tcctccgatgaaggcagcccctgccctggcatgggggggccactagatgcacctgggagc
cccctggcttgcactgaaccctcgaggacctgggcacggggtcggatggacacacagcca
gaccgtaaaccctcacgtatccccacgcctcggggcccccgccgcccctccggacccgca
gagctggggacatggcatgccctgcactcagtcaccccgagggctgagccagattcctgg
atgtga

DBGET integrated database retrieval system