KEGG   Homo sapiens (human): 10637Help
Entry
10637             CDS       T01001                                 

Gene name
LEFTY1, LEFTB, LEFTYB
Definition
(RefSeq) left-right determination factor 1
  KO
K04668  left-right determination factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    10637 (LEFTY1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    10637 (LEFTY1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   10637 (LEFTY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 10637
NCBI-ProteinID: NP_066277
OMIM: 603037
HGNC: 6552
Ensembl: ENSG00000243709
Vega: OTTHUMG00000037443
Pharos: O75610(Tbio)
UniProt: O75610
Position
1q42.12
AA seq 366 aa AA seqDB search
MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQ
YVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRL
FQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV
TEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTL
DLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQP
PEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALV
PRRLQP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccctgtggctctgctgggcactctgggtgttgcccctggccagccccggggcc
gccctgaccggggagcagctcctgggcagcctgctgcggcagctgcagctcaaagaggtg
cccaccctggacagggccgacatggaggagctggtcatccccacccacgtgagggcccag
tacgtggccctgctgcagcgcagccacggggaccgctcccgcggaaagaggttcagccag
agcttccgagaggtggccggcaggttcctggcgttggaggccagcacacacctgctggtg
ttcggcatggagcagcggctgccgcccaacagcgagctggtgcaggccgtgctgcggctc
ttccaggagccggtccccaaggccgcgctgcacaggcacgggcggctgtccccgcgcagc
gcccgggcccgggtgaccgtcgagtggctgcgcgtccgcgacgacggctccaaccgcacc
tccctcatcgactccaggctggtgtccgtccacgagagcggctggaaggccttcgacgtg
accgaggccgtgaacttctggcagcagctgagccggccccggcagccgctgctgctacag
gtgtcggtgcagagggagcatctgggcccgctggcgtccggcgcccacaagctggtccgc
tttgcctcgcagggggcgccagccgggcttggggagccccagctggagctgcacaccctg
gaccttggggactatggagctcagggcgactgtgaccctgaagcaccaatgaccgagggc
acccgctgctgccgccaggagatgtacattgacctgcaggggatgaagtgggccgagaac
tgggtgctggagcccccgggcttcctggcttatgagtgtgtgggcacctgccggcagccc
ccggaggccctggccttcaagtggccgtttctggggcctcgacagtgcatcgcctcggag
actgactcgctgcccatgatcgtcagcatcaaggagggaggcaggaccaggccccaggtg
gtcagcctgcccaacatgagggtgcagaagtgcagctgtgcctcggatggtgcgctcgtg
ccaaggaggctccagccatag

KEGG   Homo sapiens (human): 7044Help
Entry
7044              CDS       T01001                                 

Gene name
LEFTY2, EBAF, LEFTA, LEFTYA, TGFB4
Definition
(RefSeq) left-right determination factor 2
  KO
K04668  left-right determination factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    7044 (LEFTY2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7044 (LEFTY2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7044 (LEFTY2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   7044 (LEFTY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 7044
NCBI-ProteinID: NP_003231
OMIM: 601877
HGNC: 3122
Ensembl: ENSG00000143768
Vega: OTTHUMG00000037441
Pharos: O00292(Tbio)
UniProt: O00292 A0A024R3P5
Position
1q42.12
AA seq 366 aa AA seqDB search
MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQ
YVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRL
FQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV
TEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTL
DLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQP
PEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALV
PRRLQP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccctgtggctctgctgggcactctgggtgctgcccctggctggccccggggcg
gccctgaccgaggagcagctcctgggcagcctgctgcggcagctgcagctcagcgaggtg
cccgtactggacagggccgacatggagaagctggtcatccccgcccacgtgagggcccag
tatgtagtcctgctgcggcgcagccacggggaccgctcccgcggaaagaggttcagccag
agcttccgagaggtggccggcaggttcctggcgtcggaggccagcacacacctgctggtg
ttcggcatggagcagcggctgccgcccaacagcgagctggtgcaggccgtgctgcggctc
ttccaggagccggtccccaaggccgcgctgcacaggcacgggcggctgtccccgcgcagc
gcccaggcccgggtgaccgtcgagtggctgcgcgtccgcgacgacggctccaaccgcacc
tccctcatcgactccaggctggtgtccgtccacgagagcggctggaaggccttcgacgtg
accgaggccgtgaacttctggcagcagctgagccggccccggcagccgctgctgctacag
gtgtcggtgcagagggagcatctgggcccgctggcgtccggcgcccacaagctggtccgc
tttgcctcgcagggggcgccagccgggcttggggagccccagctggagctgcacaccctg
gacctcagggactatggagctcagggcgactgtgaccctgaagcaccaatgaccgagggc
acccgctgctgccgccaggagatgtacattgacctgcaggggatgaagtgggccaagaac
tgggtgctggagcccccgggcttcctggcttacgagtgtgtgggcacctgccagcagccc
ccggaggccctggccttcaattggccatttctggggccgcgacagtgtatcgcctcggag
actgcctcgctgcccatgatcgtcagcatcaaggagggaggcaggaccaggccccaggtg
gtcagcctgcccaacatgagggtgcagaagtgcagctgtgcctcggatggggcgctcgtg
ccaaggaggctccagccatag

DBGET integrated database retrieval system