KEGG   Homo sapiens (human): 10640
Entry
10640             CDS       T01001                                 

Symbol
EXOC5, HSEC10, PRO1912, SEC10, SEC10L1, SEC10P
Name
(RefSeq) exocyst complex component 5
  KO
K19984  exocyst complex component 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10640 (EXOC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10640 (EXOC5)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    10640 (EXOC5)
SSDB
Motif
Pfam: Sec10 V_ATPase_I
Other DBs
NCBI-GeneID: 10640
NCBI-ProteinID: NP_006535
OMIM: 604469
HGNC: 10696
Ensembl: ENSG00000070367
Vega: OTTHUMG00000171309
Pharos: O00471(Tbio)
UniProt: O00471
Position
14q22.3
AA seq 708 aa
MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHIQELQIMDERI
QRKVEKLEQQCQKEAKEFAKKVQELQKSNQVAFQHFQELDEHISYVATKVCHLGDQLEGV
NTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKIKEAADIIQKLHLIAQELPFDRFSE
VKSKIASKYHDLECQLIQEFTSAQRRGEISRMREVAAVLLHFKGYSHCVDVYIKQCQEGA
YLRNDIFEDAGILCQRVNKQVGDIFSNPETVLAKLIQNVFEIKLQSFVKEQLEECRKSDA
EQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTFLSKLIKSIFISYLENYIEVETGYLKSR
SAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVNLL
QETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNANL
YFLDVVQQANTIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTL
NCMIGQMKHILAAEQKKTDFKPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVD
TVLMELGVRFHRLIYEHLQQYSYSCMGGMLAICDVAEYRKCAKDFKIPMVLHLFDTLHAL
CNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRSARLARHFS
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggctaccacggccgagctcttcgaggagccttttgtggcagatgaatatattgaacgt
cttgtatggagaaccccaggaggaggctctagaggtggacctgaagcttttgatcctaaa
agattattagaagaatttgtaaatcatattcaggaactccagataatggatgaaaggatt
cagaggaaagtagagaaactagagcaacaatgtcagaaagaagccaaggaatttgccaag
aaggtacaagagctgcagaaaagcaatcaggttgccttccaacatttccaagaactagat
gagcacattagctatgtagcaactaaagtctgtcaccttggagaccagttagagggggta
aacacacccagacaacgggcagtggaggctcagaaattgatgaaatactttaatgagttt
ctagatggagaattgaaatctgatgtttttacaaattctgaaaagataaaggaagcagca
gacatcattcagaagttgcacctaattgcccaagagttaccttttgatagattttcagaa
gttaaatccaaaattgcaagtaaataccatgatttagaatgccagctgattcaggagttt
accagtgctcaaagaagaggtgaaatctccagaatgagagaagtagcagcagttttactt
cattttaagggttattcccattgtgttgatgtttatataaagcagtgccaggagggtgct
tatttgagaaatgatatatttgaagacgctggaatactctgtcaaagagtgaacaaacaa
gttggagatatcttcagtaatccagaaacagtcctggctaaacttattcaaaatgtattt
gaaatcaaactacagagttttgtgaaagagcagttagaagaatgtaggaagtccgatgca
gagcaatatctcaaaaatctctatgatctgtatacaagaaccaccaatctttccagcaag
ctgatggagtttaatttaggtactgataaacagactttcttgtctaagcttatcaaatcc
attttcatttcctatttggagaactatattgaggtggagactggatatttgaaaagcaga
agtgctatgatcctacagcgctattatgattcgaaaaaccatcaaaagagatccattggc
acaggaggtattcaagatttgaaggaaagaattagacagcgtaccaacttaccacttggg
ccaagtatcgatactcatggggagacttttctatcccaagaagtggtggttaatctttta
caagaaaccaaacaagcctttgaaagatgtcataggctctctgatccttctgacttacca
aggaatgccttcagaatttttaccattcttgtggaatttttatgtattgagcatattgat
tatgctttggaaacaggacttgctggaattccctcttcagattctaggaatgcaaatctt
tattttttggacgttgtgcaacaggccaatactatttttcatctttttgacaaacagttt
aatgatcaccttatgccactaataagctcttctcctaagttatctgaatgccttcagaag
aaaaaagaaataattgaacaaatggagatgaaattggatactggcattgataggacatta
aattgtatgattggacagatgaagcatattttggctgcagaacagaagaaaacagatttt
aagccagaagatgaaaacaatgttttgattcaatatactaatgcctgtgtaaaagtctgt
gcttacgtaagaaaacaagtggagaagattaaaaattccatggatgggaagaatgtggat
acagttttgatggaacttggagtacgttttcatcgacttatctatgagcatcttcaacaa
tattcctacagttgtatgggtggcatgttggccatttgtgatgtagccgaatataggaag
tgtgccaaagacttcaagattccaatggtattacatctttttgatactctgcatgctctt
tgcaatcttctggtagttgccccagataatttaaagcaagtctgctcaggagaacaactt
gctaatctggacaagaatatacttcactccttcgtacaacttcgtgctgattatagatct
gcccgccttgctcgacacttcagctga

DBGET integrated database retrieval system