KEGG   Homo sapiens (human): 10645Help
Entry
10645             CDS       T01001                                 

Gene name
CAMKK2, CAMKK, CAMKKB
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 2
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    10645 (CAMKK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10645 (CAMKK2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    10645 (CAMKK2)
   04921 Oxytocin signaling pathway
    10645 (CAMKK2)
  09149 Aging
   04211 Longevity regulating pathway
    10645 (CAMKK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    10645 (CAMKK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10645 (CAMKK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     10645 (CAMKK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  CAMKK family
   10645 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 10645
NCBI-ProteinID: NP_001257414
OMIM: 615002
HGNC: 1470
Ensembl: ENSG00000110931
Vega: OTTHUMG00000169156
Pharos: Q96RR4(Tchem)
UniProt: Q96RR4 A0A024RBQ0
Structure
PDB: 

Position
12q24.31
AA seq 588 aa AA seqDB search
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgtgtctctagccagcccagcagcaaccgggccgccccccaggatgagctg
gggggcaggggcagcagcagcagcgaaagccagaagccctgtgaggccctgcggggcctc
tcatccttgagcatccacctgggcatggagtccttcattgtggtcaccgagtgtgagccg
ggctgtgctgtggacctcggcttggcgcgggaccggcccctggaggccgatggccaagag
gtcccccttgacacctccgggtcccaggcccggccccacctctccggtcgcaagctgtct
ctgcaagagcggtcccagggtgggctggcagccggtggcagcctggacatgaacggacgc
tgcatctgcccgtccctgccctactcacccgtcagctccccgcagtcctcgcctcggctg
ccccggcggccgacagtggagtctcaccacgtctccatcacgggtatgcaggactgtgtg
cagctgaatcagtataccctgaaggatgaaattggaaagggctcctatggtgtcgtcaag
ttggcctacaatgaaaatgacaatacctactatgcaatgaaggtgctgtccaaaaagaag
ctgatccggcaggccggctttccacgtcgccctccaccccgaggcacccggccagctcct
ggaggctgcatccagcccaggggccccattgagcaggtgtaccaggaaattgccatcctc
aagaagctggaccaccccaatgtggtgaagctggtggaggtcctggatgaccccaatgag
gaccatctgtacatggtgttcgaactggtcaaccaagggcccgtgatggaagtgcccacc
ctcaaaccactctctgaagaccaggcccgtttctacttccaggatctgatcaaaggcatc
gagtacttacactaccagaagatcatccaccgtgacatcaaaccttccaacctcctggtc
ggagaagatgggcacatcaagatcgctgactttggtgtgagcaatgaattcaagggcagt
gacgcgctcctctccaacaccgtgggcacgcccgccttcatggcacccgagtcgctctct
gagacccgcaagatcttctctgggaaggccttggatgtttgggccatgggtgtgacacta
tactgctttgtctttggccagtgcccattcatggacgagcggatcatgtgtttacacagt
aagatcaagagtcaggccctggaatttccagaccagcccgacatagctgaggacttgaag
gacctgatcacccgtatgctggacaagaaccccgagtcgaggatcgtggtgccggaaatc
aagctgcacccctgggtcacgaggcatggggcggagccgttgccgtcggaggatgagaac
tgcacgctggtcgaagtgactgaagaggaggtcgagaactcagtcaaacacattcccagc
ttggcaaccgtgatcctggtgaagaccatgatacgtaaacgctcctttgggaacccattc
gagggcagccggcgggaggaacgctcactgtcagcgcctggaaacttgctcaccaaaaaa
ccaaccagggaatgtgagtccctgtctgagctcaaggaagcaaggcagcgaagacaacct
ccagggcaccgacccgccccccgtgggggaggaggaagtgctcttgtgagaggcagtccc
tgcgtggaaagttgctgggcccccgcccccggctcccccgcacgcatgcatccactgcgg
ccggaggaggccatggagcccgagtag

DBGET integrated database retrieval system