KEGG   Homo sapiens (human): 10645Help
Entry
10645             CDS       T01001                                 

Gene name
CAMKK2, CAMKK, CAMKKB
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 2
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    10645 (CAMKK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10645 (CAMKK2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    10645 (CAMKK2)
   04921 Oxytocin signaling pathway
    10645 (CAMKK2)
  09149 Aging
   04211 Longevity regulating pathway
    10645 (CAMKK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    10645 (CAMKK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10645 (CAMKK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     10645 (CAMKK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  CAMKK family
   10645 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 10645
NCBI-ProteinID: NP_001257414
OMIM: 615002
HGNC: 1470
Ensembl: ENSG00000110931
Vega: OTTHUMG00000169156
Pharos: Q96RR4(Tchem)
UniProt: Q96RR4 A0A024RBQ0
Structure
PDB: 

Position
12q24.31
AA seq 588 aa AA seqDB search
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgtgtctctagccagcccagcagcaaccgggccgccccccaggatgagctg
gggggcaggggcagcagcagcagcgaaagccagaagccctgtgaggccctgcggggcctc
tcatccttgagcatccacctgggcatggagtccttcattgtggtcaccgagtgtgagccg
ggctgtgctgtggacctcggcttggcgcgggaccggcccctggaggccgatggccaagag
gtcccccttgacacctccgggtcccaggcccggccccacctctccggtcgcaagctgtct
ctgcaagagcggtcccagggtgggctggcagccggtggcagcctggacatgaacggacgc
tgcatctgcccgtccctgccctactcacccgtcagctccccgcagtcctcgcctcggctg
ccccggcggccgacagtggagtctcaccacgtctccatcacgggtatgcaggactgtgtg
cagctgaatcagtataccctgaaggatgaaattggaaagggctcctatggtgtcgtcaag
ttggcctacaatgaaaatgacaatacctactatgcaatgaaggtgctgtccaaaaagaag
ctgatccggcaggccggctttccacgtcgccctccaccccgaggcacccggccagctcct
ggaggctgcatccagcccaggggccccattgagcaggtgtaccaggaaattgccatcctc
aagaagctggaccaccccaatgtggtgaagctggtggaggtcctggatgaccccaatgag
gaccatctgtacatggtgttcgaactggtcaaccaagggcccgtgatggaagtgcccacc
ctcaaaccactctctgaagaccaggcccgtttctacttccaggatctgatcaaaggcatc
gagtacttacactaccagaagatcatccaccgtgacatcaaaccttccaacctcctggtc
ggagaagatgggcacatcaagatcgctgactttggtgtgagcaatgaattcaagggcagt
gacgcgctcctctccaacaccgtgggcacgcccgccttcatggcacccgagtcgctctct
gagacccgcaagatcttctctgggaaggccttggatgtttgggccatgggtgtgacacta
tactgctttgtctttggccagtgcccattcatggacgagcggatcatgtgtttacacagt
aagatcaagagtcaggccctggaatttccagaccagcccgacatagctgaggacttgaag
gacctgatcacccgtatgctggacaagaaccccgagtcgaggatcgtggtgccggaaatc
aagctgcacccctgggtcacgaggcatggggcggagccgttgccgtcggaggatgagaac
tgcacgctggtcgaagtgactgaagaggaggtcgagaactcagtcaaacacattcccagc
ttggcaaccgtgatcctggtgaagaccatgatacgtaaacgctcctttgggaacccattc
gagggcagccggcgggaggaacgctcactgtcagcgcctggaaacttgctcaccaaaaaa
ccaaccagggaatgtgagtccctgtctgagctcaaggaagcaaggcagcgaagacaacct
ccagggcaccgacccgccccccgtgggggaggaggaagtgctcttgtgagaggcagtccc
tgcgtggaaagttgctgggcccccgcccccggctcccccgcacgcatgcatccactgcgg
ccggaggaggccatggagcccgagtag

KEGG   Homo sapiens (human): 6794Help
Entry
6794              CDS       T01001                                 

Gene name
STK11, LKB1, PJS, hLKB1
Definition
(RefSeq) serine/threonine kinase 11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04530  Tight junction
hsa04920  Adipocytokine signaling pathway
Disease
H00019  Pancreatic cancer
H00666  Peutz-Jeghers syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    6794 (STK11)
   04151 PI3K-Akt signaling pathway
    6794 (STK11)
   04152 AMPK signaling pathway
    6794 (STK11)
   04150 mTOR signaling pathway
    6794 (STK11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6794 (STK11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    6794 (STK11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    6794 (STK11)
  09149 Aging
   04211 Longevity regulating pathway
    6794 (STK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6794 (STK11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6794 (STK11)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   6794 (STK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 6794
NCBI-ProteinID: NP_000446
OMIM: 602216
HGNC: 11389
Ensembl: ENSG00000118046
Vega: OTTHUMG00000180118
Pharos: Q15831(Tchem)
UniProt: Q15831 A0A0S2Z4D1
Structure
PDB: 

Position
19p13.3
AA seq 433 aa AA seqDB search
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI
IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA
SSKIRRLSACKQQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtggacccgcagcagctgggcatgttcacggagggcgagctgatgtcggtg
ggtatggacacgttcatccaccgcatcgactccaccgaggtcatctaccagccgcgccgc
aagcgggccaagctcatcggcaagtacctgatgggggacctgctgggggaaggctcttac
ggcaaggtgaaggaggtgctggactcggagacgctgtgcaggagggccgtcaagatcctc
aagaagaagaagttgcgaaggatccccaacggggaggccaacgtgaagaaggaaattcaa
ctactgaggaggttacggcacaaaaatgtcatccagctggtggatgtgttatacaacgaa
gagaagcagaaaatgtatatggtgatggagtactgcgtgtgtggcatgcaggaaatgctg
gacagcgtgccggagaagcgtttcccagtgtgccaggcccacgggtacttctgtcagctg
attgacggcctggagtacctgcatagccagggcattgtgcacaaggacatcaagccgggg
aacctgctgctcaccaccggtggcaccctcaaaatctccgacctgggcgtggccgaggca
ctgcacccgttcgcggcggacgacacctgccggaccagccagggctccccggctttccag
ccgcccgagattgccaacggcctggacaccttctccggcttcaaggtggacatctggtcg
gctggggtcaccctctacaacatcaccacgggtctgtaccccttcgaaggggacaacatc
tacaagttgtttgagaacatcgggaaggggagctacgccatcccgggcgactgtggcccc
ccgctctctgacctgctgaaagggatgcttgagtacgaaccggccaagaggttctccatc
cggcagatccggcagcacagctggttccggaagaaacatcctccggctgaagcaccagtg
cccatcccaccgagcccagacaccaaggaccggtggcgcagcatgactgtggtgccgtac
ttggaggacctgcacggcgcggacgaggacgaggacctcttcgacatcgaggatgacatc
atctacactcaggacttcacggtgcccggacaggtcccagaagaggaggccagtcacaat
ggacagcgccggggcctccccaaggccgtgtgtatgaacggcacagaggcggcgcagctg
agcaccaaatccagggcggagggccgggcccccaaccctgcccgcaaggcctgctccgcc
agcagcaagatccgccggctgtcggcctgcaagcagcagtga

KEGG   Homo sapiens (human): 84254Help
Entry
84254             CDS       T01001                                 

Gene name
CAMKK1, CAMKKA
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    84254 (CAMKK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    84254 (CAMKK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     84254 (CAMKK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  CAMKK family
   84254 (CAMKK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 84254
NCBI-ProteinID: NP_115670
OMIM: 611411
HGNC: 1469
Ensembl: ENSG00000004660
Vega: OTTHUMG00000090725
Pharos: Q8N5S9(Tchem)
UniProt: Q8N5S9
Structure
PDB: 

Position
17p13.2
AA seq 505 aa AA seqDB search
MEGGPAVCCQDPRAELVERVAAIDVTHLEEADGGPEPTRNGVDPPPRARAASVIPGSTSR
LLPARPSLSARKLSLQERPAGSYLEAQAGPYATGPASHISPRAWRRPTIESHHVAISDAE
DCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
AAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVME
VPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQF
EGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILA
LHRKIKNEPVVFPEEPEISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSE
EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNL
LVKEGFGEGGKSPELPGVQEDEAAS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggaggggggtccagctgtctgctgccaggatcctcgggcagagctggtagaacgggtg
gcagccatcgatgtgactcacttggaggaggcagatggtggcccagagcctactagaaac
ggtgtggaccccccaccacgggccagagctgcctctgtgatccctggcagtacttcaaga
ctgctcccagcccggcctagcctctcagccaggaagctttccctacaggagcggccagca
ggaagctatctggaggcgcaggctgggccttatgccacggggcctgccagccacatctcc
ccccgggcctggcggaggcccaccatcgagtcccaccacgtggccatctcagatgcagag
gactgcgtgcagctgaaccagtacaagctgcagagtgagattggcaagggtgcctacggt
gtggtgaggctggcctacaacgaaagtgaagacagacactatgcaatgaaagtcctttcc
aaaaagaagttactgaagcagtatggctttccacgtcgccctcccccgagagggtcccag
gctgcccagggaggaccagccaagcagctgctgcccctggagcgggtgtaccaggagatt
gccatcctgaagaagctggaccacgtgaatgtggtcaaactgatcgaggtcctggatgac
ccagctgaggacaacctctatttggtgtttgacctcctgagaaaggggcccgtcatggaa
gtgccctgtgacaagcccttctcggaggagcaagctcgcctctacctgcgggacgtcatc
ctgggcctcgagtacttgcactgccagaagatcgtccacagggacatcaagccatccaac
ctgctcctgggggatgatgggcacgtgaagatcgccgactttggcgtcagcaaccagttt
gaggggaacgacgctcagctgtccagcacggcgggaaccccagcattcatggcccccgag
gccatttctgattccggccagagcttcagtgggaaggccttggatgtatgggccactggc
gtcacgttgtactgctttgtctatgggaagtgcccattcatcgacgatttcatcctggcc
ctccacaggaagatcaagaatgagcccgtggtgtttcctgaggagccagaaatcagcgag
gagctcaaggacctgatcctgaagatgttagacaagaatcccgagacgagaattggggtg
ccagacatcaagttgcacccttgggtgaccaagaacggggaggagccccttccttcggag
gaggagcactgcagcgtggtggaggtgacagaggaggaggttaagaactcagtcaggctc
atccccagctggaccacggtgatcctggtgaagtccatgctgaggaagcgttcctttggg
aacccgtttgagccccaagcacggagggaagagcgatccatgtctgctccaggaaaccta
ctggtgaaagaagggtttggtgaagggggcaagagcccagagctccccggcgtccaggaa
gacgaggctgcatcctga

DBGET integrated database retrieval system