KEGG   Homo sapiens (human): 10655
Entry
10655             CDS       T01001                                 

Gene name
DMRT2, DSXL-2
Definition
(RefSeq) doublesex and mab-3 related transcription factor 2
  KO
K19489  doublesex- and mab-3-related transcription factor 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10655 (DMRT2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   DMRT
    10655 (DMRT2)
SSDB
Motif
Pfam: DM TraK
Other DBs
NCBI-GeneID: 10655
NCBI-ProteinID: NP_870987
OMIM: 604935
HGNC: 2935
Ensembl: ENSG00000173253
Vega: OTTHUMG00000019437
Pharos: Q9Y5R5(Tdark)
UniProt: Q9Y5R5 Q05C20
Position
9p24.3
AA seq 561 aa
MADPQAGSAAGDWEIDVESLELEEDVCGAPRSTPPGPSPPPADGDCEDDEDDDGVDEDAE
EEGDGEEAGASPGMPGQPEQRGGPQPRPPLAPQASPAGTGPRERCTPAGGGAEPRKLSRT
PKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGL
SGKQNNFERKAVYQRQVRAPSLLAKSILEGYRPIPAETYVGGTFPLPPPVSDRMRKRRAF
ADKELENIMLEREYKEREMLETSQAAALFLPNRMVPGPDYNSYKSAYSPSPVEPPSKDFC
NFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQCL
LNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGH
QAVPERSAFSPPRRNFSPIVDTDSLAAQGHVLTKISKENTRHPLPLRHNPFHSLFQQTLT
DKSGPELKTPFVKEAFEETPKKHRECLVKDNQKYTFTIDRCAKDLFVAKQVGTKLSVNEP
LSFSVESILKRPSSAITRVSQ
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggccgacccgcaggctggctccgcggccggggactgggagatcgatgtcgagagcctg
gagctggaagaggacgtctgcggggcgccgcggtccacgccccccgggcccagcccgccg
ccggcggacggggactgcgaggacgacgaagatgacgacggggtggacgaagacgcggaa
gaagagggcgacggcgaggaggcaggcgcgtcccccgggatgcccggccagccggagcag
cgggggggaccgcagccgaggccgccgctcgcgcctcaggcctcacccgccggcaccggt
ccccgagagcgctgcactcccgcgggcggcggcgcggagccgcgcaagctgagccgcacg
cccaagtgcgcgcgctgccgcaaccacggcgtggtgtcctgcctgaagggccacaagcgc
ttctgtcgctggcgcgactgccagtgcgccaactgcctgctggtggtggagcggcagcgc
gtcatggccgcccaggtggcgctccggaggcagcaggccaccgaggacaagaaggggctt
tccgggaaacagaataatttcgagcgcaaagctgtgtaccagaggcaagtcagagccccc
agtttgctggccaaaagcattttagaaggctatcgccccattccagcggagacttatgta
ggagggaccttccctctacctcccccagttagtgacaggatgaggaaaagaagagccttt
gctgataaagagttggagaacattatgctggagagagaatataaagaaagggagatgttg
gaaacttctcaagctgctgctctgtttctgcccaaccgcatggtgcctggacctgactac
aattcctacaaaagtgcctacagccccagcccagtggaaccaccaagcaaggacttctgt
aattttttgcccacctgccttgatttaaccatgcagtattcagggtctgggaatatggaa
ctaatttcttctaatgtcagcgtggccacaacttatagacagtatcccttgtcctcaaga
tttttagtttggcccaagtgtggccccattagcgacaccctcctctaccagcaatgcctg
ctaaatgccaccacctcagttcaagccctgaagcctggggccagctgggacttgaaggga
gcacgagtccaggatggactcagtgcagagcaggacatgatgccatcgaaattggaaggt
tccctggtgctgcctcacactcctgagatccagaccacgagaagtgaccttcagggtcat
caggctgtcccagagaggtccgcgttctccccaccccgacggaatttctctcccattgtt
gacacggactccctggcagctcaagggcatgtcttaacgaagatcagcaaagaaaacacc
aggcaccctctgccacttagacataatccattccactcattattccagcaaacacttact
gacaaatcgggtcctgagttgaaaacaccatttgtcaaagaggcctttgaagagacccct
aagaaacacagagagtgtttagttaaggacaaccagaagtacacatttacaatagataga
tgtgcaaaagacctttttgtagccaaacaagttggaacaaaactctcggtgaatgaacca
ctgtcattttctgttgagtctattcttaagaggccttcatctgccatcactcgtgtctct
cagtga

DBGET integrated database retrieval system