KEGG   Homo sapiens (human): 10656Help
Entry
10656             CDS       T01001                                 

Gene name
KHDRBS3, Etle, SALP, SLM-2, SLM2, T-STAR, TSTAR, etoile
Definition
(RefSeq) KH RNA binding domain containing, signal transduction associated 3
  KO
K14942  KH domain-containing, RNA-binding, signal transduction-associated protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10656 (KHDRBS3)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    10656 (KHDRBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Qua1 Sam68-YY KH_1 STAR_dimer
Motif
Other DBs
NCBI-GeneID: 10656
NCBI-ProteinID: NP_006549
OMIM: 610421
HGNC: 18117
Ensembl: ENSG00000131773
Vega: OTTHUMG00000164164
Pharos: O75525(Tbio)
UniProt: O75525
Structure
PDB: 

Position
8q24.23
AA seq 346 aa AA seqDB search
MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVINKNMKLGQKV
LIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKY
FHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSEN
ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRG
LLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDSYDNSYSTPAQSGAD
YYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaagtacctgcccgagctgatggcggagaaggactccctggacccctccttc
acgcacgccctgcgcctggtgaaccaagaaatagaaaagtttcaaaaaggagaaggcaag
gatgaagaaaagtacatcgatgtggtgattaataagaacatgaagctgggacagaaagtg
ttaattcccgtaaaacagttccctaagttcaactttgtggggaaacttttgggtccacgt
ggcaattctctgaagcgtttacaagaagaaaccttgacaaaaatgtccatccttgggaaa
ggttccatgagagacaaggccaaggaagaagagttgaggaaaagtggagaagcgaagtac
ttccatctcaatgatgatctccatgttctcattgaagtgtttgccccacctgcagaagct
tatgccaggatgggacatgctttggaagaaatcaaaaagttcctcatccctgattataat
gatgagatcaggcaagcacagctccaggagttaacatatttgaatggtggttcagaaaat
gcagatgttccagtggttcgagggaaacccaccttgcgtacaagaggtgtaccagcccca
gcaataaccaggggaaggggaggagttacagcccggccagttggagttgtagtaccacga
gggacgccaactcccagaggagtcctgtccacccgagggccagtgagtcggggaagagga
cttctcactcccagagcaagaggagtccccccaactgggtacagacctccaccgccaccc
ccgacacaagagacttatggagaatatgactatgatgatggatatggcactgcttatgat
gaacagagttatgattcctatgataacagctatagcaccccagcccaaagtggtgctgat
tactatgattacggacatggactcagtgaggagacttatgattcctacgggcaagaagag
tggactaactcaagacacaaggcaccttcagcgaggacagcaaagggcgtctacagagac
cagccatatggcagatactga

DBGET integrated database retrieval system