KEGG   Homo sapiens (human): 10657Help
Entry
10657             CDS       T01001                                 

Gene name
KHDRBS1, Sam68, p62, p68
Definition
(RefSeq) KH RNA binding domain containing, signal transduction associated 1
  KO
K13198  KH domain-containing, RNA-binding, signal transduction-associated protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10657 (KHDRBS1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    10657 (KHDRBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Qua1 Sam68-YY KH_1
Motif
Other DBs
NCBI-GeneID: 10657
NCBI-ProteinID: NP_006550
OMIM: 602489
HGNC: 18116
Ensembl: ENSG00000121774
Vega: OTTHUMG00000003921
Pharos: Q07666(Tbio)
UniProt: Q07666
Structure
PDB: 

Position
1p35.2
AA seq 443 aa AA seqDB search
MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPA
TQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTH
AMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQ
GNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEA
YALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPV
PRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPP
PAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR
PSLKAPPARPVKGAYREHPYGRY
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccgggacgaccccgccgcgcgcatgagccggtcttcgggccgtagcggctcc
atggacccctccggtgcccacccctcggtgcgtcagacgccgtctcggcagccgccgctg
cctcaccggtcccggggaggcggagggggatcccgcgggggcgcccgggcctcgcccgcc
acgcagccgccaccgctgctgccgccctcggccacgggtcccgacgcgacagtgggcggg
ccagcgccgaccccgctgctgcccccctcggccacagcctcggtcaagatggagccagag
aacaagtacctgcccgaactcatggccgagaaggactcgctcgacccgtccttcactcac
gccatgcagctgctgacggcagaaattgagaagattcagaaaggagactcaaaaaaggat
gatgaggagaattacttggatttattttctcataagaacatgaaactgaaagagcgagtg
ctgatacctgtcaagcagtatcccaagttcaattttgtggggaagattcttggaccacaa
gggaatacaatcaaaagactgcaggaagagactggtgcaaagatctctgtattgggaaag
ggctcaatgagagacaaagccaaggaggaagagctgcgcaaaggtggagaccccaaatat
gcccacttgaatatggatctgcatgtcttcattgaagtctttggacccccatgtgaggct
tatgctcttatggcccatgccatggaggaagtcaagaaatttctagtaccggatatgatg
gatgatatctgtcaggagcaatttctagagctgtcctacttgaatggagtacctgaaccc
tctcgtggacgtggggtgccagtgagaggccggggagctgcacctcctccaccacctgtt
cccaggggccgtggtgttggaccacctcggggggctttggtacgtggtacaccagtaagg
ggagccatcaccagaggtgccactgtgactcgaggcgtgccacccccacctactgtgagg
ggtgctccagcaccaagagcacggacagcgggcatccagaggatacctttgcctccacct
cctgcaccagaaacatatgaagaatatggatatgatgatacatacgcagaacaaagttac
gaaggctacgaaggctattacagccagagtcaaggggactcagaatattatgactatgga
catggggaggttcaagattcttatgaagcttatggccaggacgactggaatgggaccagg
ccgtcgctgaaggcccctcctgctaggccagtgaagggagcatacagagagcacccatat
ggacgttattaa

DBGET integrated database retrieval system