KEGG   Homo sapiens (human): 1066Help
Entry
1066              CDS       T01001                                 

Gene name
CES1, ACAT, CE-1, CEH, CES2, HMSE, HMSE1, PCE-1, REH, SES1, TGH, hCE-1
Definition
(RefSeq) carboxylesterase 1
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    1066 (CES1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     1066 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Say1_Mug180 Esterase Abhydrolase_6 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 1066
NCBI-ProteinID: NP_001020365
OMIM: 114835
HGNC: 1863
Ensembl: ENSG00000198848
Vega: OTTHUMG00000176718
Pharos: P23141(Tchem)
UniProt: P23141
Structure
PDB: 

Position
16q12.2
AA seq 567 aa AA seqDB search
MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPL
GPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK
MKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP
MQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL
IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPF
LKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLK
DKEVAFWTNLFAKKAVEKPPQTEHIEL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccgtgcctttatcctggccactctctctgcttccgcggcttgggggcatccg
tcctcgccacctgtggtggacaccgtgcatggcaaagtgctggggaagttcgtcagctta
gaaggatttgcacagcctgtggccattttcctgggaatcccttttgccaagccgcctctt
ggacccctgaggtttactccaccgcagcctgcagaaccatggagctttgtgaagaatgcc
acctcgtaccctcctatgtgcacccaagatcccaaggcggggcagttactctcagagcta
tttacaaaccgaaaggagaacattcctctcaagctttctgaagactgtctttacctcaat
atttacactcctgctgacttgaccaagaaaaacaggctgccggtgatggtgtggatccac
ggaggggggctgatggtgggtgcggcatcaacctatgatgggctggcccttgctgcccat
gaaaacgtggtggtggtgaccattcaatatcgcctgggcatctggggattcttcagcaca
ggggatgaacacagccgggggaactggggtcacctggaccaggtggctgccctgcgctgg
gtccaggacaacattgccagctttggagggaacccaggctctgtgaccatctttggagag
tcagcgggaggagaaagtgtctctgttcttgttttgtctccattggccaagaacctcttc
caccgggccatttctgagagtggcgtggccctcacttctgttctggtgaagaaaggtgat
gtcaagcccttggctgagcaaattgctatcactgctgggtgcaaaaccaccacctctgct
gtcatggttcactgcctgcgacagaagacggaagaggagctcttggagacgacattgaaa
atgaaattcttatctctggacttacagggagaccccagagagagtcaaccccttctgggc
actgtgattgatgggatgctgctgctgaaaacacctgaagagcttcaagctgaaaggaat
ttccacactgtcccctacatggtcggaattaacaagcaggagtttggctggttgattcca
atgcagttgatgagctatccactctccgaagggcaactggaccagaagacagccatgtca
ctcctgtggaagtcctatccccttgtttgcattgctaaggaactgattccagaagccact
gagaaatacttaggaggaacagacgacactgtcaaaaagaaagacctgttcctggacttg
atagcagatgtgatgtttggtgtcccatctgtgattgtggcccggaaccacagagatgct
ggagcacccacctacatgtatgagtttcagtaccgtccaagcttctcatcagacatgaaa
cccaagacggtgataggagaccacggggatgagctcttctccgtctttggggccccattt
ttaaaagagggtgcctcagaagaggagatcagacttagcaagatggtgatgaaattctgg
gccaactttgctcgcaatggaaaccccaatggggaagggctgccccactggccagagtac
aaccagaaggaagggtatctgcagattggtgccaacacccaggcggcccagaagctgaag
gacaaagaagtagctttctggaccaacctctttgccaagaaggcagtggagaagccaccc
cagacagaacacatagagctgtga

KEGG   Homo sapiens (human): 8824Help
Entry
8824              CDS       T01001                                 

Gene name
CES2, CE-2, CES2A1, PCE-2, iCE
Definition
(RefSeq) carboxylesterase 2
  KO
K03927  carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    8824 (CES2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     8824 (CES2)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     8824 (CES2)
    3.1.1.84  cocaine esterase
     8824 (CES2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Say1_Mug180 Esterase
Motif
Other DBs
NCBI-GeneID: 8824
NCBI-ProteinID: NP_003860
OMIM: 605278
HGNC: 1864
Ensembl: ENSG00000172831
Vega: OTTHUMG00000137517
Pharos: O00748(Tchem)
UniProt: O00748
Position
16q22.1
AA seq 559 aa AA seqDB search
MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLG
IPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMS
EDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLG
VLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSLVVS
PISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSEALVGCLRGKSKEEI
LAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQ
KEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPA
LQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEE
EQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKK
ALPQKIQELEEPEERHTEL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcacagacttcgtgcgcggctgagcgcggtggcctgtgggcttctgctgctt
cttgtccggggccagggccaggactcagccagtcccatccggaccacacacacggggcag
gtgctggggagtcttgtccatgtgaagggcgccaatgccggggtccaaaccttcctggga
attccatttgccaagccacctctaggtccgctgcgatttgcaccccctgagccccctgaa
tcttggagtggtgtgagggatggaaccacccatccggccatgtgtctacaggacctcacc
gcagtggagtcagagtttcttagccagttcaacatgaccttcccttccgactccatgtct
gaggactgcctgtacctcagcatctacacgccggcccatagccatgaaggctctaacctg
ccggtgatggtgtggatccacggtggtgcgcttgtttttggcatggcttccttgtatgat
ggttccatgctggctgccttggagaacgtggtggtggtcatcatccagtaccgcctgggt
gtcctgggcttcttcagcactggagacaagcacgcaaccggcaactggggctacctggac
caagtggctgcactacgctgggtccagcagaatatcgcccactttggaggcaaccctgac
cgtgtcaccatttttggcgagtctgcgggtggcacgagtgtgtcttcgcttgttgtgtcc
cccatatcccaaggactcttccacggagccatcatggagagtggcgtggccctcctgccc
ggcctcattgccagctcagctgatgtcatctccacggtggtggccaacctgtctgcctgt
gaccaagttgactctgaggccctggtgggctgcctgcggggcaagagtaaagaggagatt
cttgcaattaacaagcctttcaagatgatccccggagtggtggatggggtcttcctgccc
aggcacccccaggagctgctggcctctgccgactttcagcctgtccctagcattgttggt
gtcaacaacaatgaattcggctggctcatccccaaggtcatgaggatctatgatacccag
aaggaaatggacagagaggcctcccaggctgctctgcagaaaatgttaacgctgctgatg
ttgcctcctacatttggtgacctgctgagggaggagtacattggggacaatggggatccc
cagaccctccaagcgcagttccaggagatgatggcggactccatgtttgtgatccctgca
ctccaagtagcacattttcagtgttcccgggcccctgtgtacttctacgagttccagcat
cagcccagctggctcaagaacatcaggccaccgcacatgaaggcagaccatggtgatgag
cttccttttgttttcagaagtttctttgggggcaactacattaaattcactgaggaagag
gagcagctaagcaggaagatgatgaagtactgggccaactttgcgagaaatgggaacccc
aatggcgagggtctgccacactggccgctgttcgaccaggaggagcaatacctgcagctg
aacctacagcctgcggtgggccgggctctgaaggcccacaggctccagttctggaagaag
gcgctgccccaaaagatccaggagctcgaggagcctgaagagagacacacagagctgtag

DBGET integrated database retrieval system