KEGG   Homo sapiens (human): 10663
Entry
10663             CDS       T01001                                 

Gene name
CXCR6, BONZO, CD186, STRL33, TYMSTR
Definition
(RefSeq) C-X-C motif chemokine receptor 6
  KO
K04191  C-X-C chemokine receptor type 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10663 (CXCR6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    10663 (CXCR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10663 (CXCR6)
   04050 Cytokine receptors [BR:hsa04050]
    10663 (CXCR6)
   04090 CD molecules [BR:hsa04090]
    10663 (CXCR6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    10663 (CXCR6)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   10663 (CXCR6)
CD molecules [BR:hsa04090]
 Proteins
  10663 (CXCR6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 10663
NCBI-ProteinID: NP_006555
OMIM: 605163
HGNC: 16647
Ensembl: ENSG00000172215
Vega: OTTHUMG00000133448
Pharos: O00574(Tbio)
UniProt: O00574 A0N0N3
Position
3p21.31
AA seq 342 aa
MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH
KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL
TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC
GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF
LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW
KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggcagagcatgattaccatgaagactatgggttcagcagtttcaatgacagcagccag
gaggagcatcaagacttcctgcagttcagcaaggtctttctgccctgcatgtacctggtg
gtgtttgtctgtggtctggtggggaactctctggtgctggtcatatccatcttctaccat
aagttgcagagcctgacggatgtgttcctggtgaacctacccctggctgacctggtgttt
gtctgcactctgcccttctgggcctatgcaggcatccatgaatgggtgtttggccaggtc
atgtgcaagagcctactgggcatctacactattaacttctacacgtccatgctcatcctc
acctgcatcactgtggatcgtttcattgtagtggttaaggccaccaaggcctacaaccag
caagccaagaggatgacctggggcaaggtcaccagcttgctcatctgggtgatatccctg
ctggtttccttgccccaaattatctatggcaatgtctttaatctcgacaagctcatatgt
ggttaccatgacgaggcaatttccactgtggttcttgccacccagatgacactggggttc
ttcttgccactgctcaccatgattgtctgctattcagtcataatcaaaacactgcttcat
gctggaggcttccagaagcacagatctctaaagatcatcttcctggtgatggctgtgttc
ctgctgacccagatgcccttcaacctcatgaagttcatccgcagcacacactgggaatac
tatgccatgaccagctttcactacaccatcatggtgacagaggccatcgcatacctgagg
gcctgccttaaccctgtgctctatgcctttgtcagcctgaagtttcgaaagaacttctgg
aaacttgtgaaggacattggttgcctcccttaccttggggtctcacatcaatggaaatct
tctgaggacaattccaagactttttctgcctcccacaatgtggaggccaccagcatgttc
cagttatag

KEGG   Homo sapiens (human): 10803
Entry
10803             CDS       T01001                                 

Gene name
CCR9, CC-CKR-9, CDw199, GPR-9-6, GPR28
Definition
(RefSeq) C-C motif chemokine receptor 9
  KO
K04184  C-C chemokine receptor type 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01221  CCL25 to CCR9/11 signaling
Drug target
Vercirnon (DG01370): D10378 D10379
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10803 (CCR9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    10803 (CCR9)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    10803 (CCR9)
   04062 Chemokine signaling pathway
    10803 (CCR9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10803 (CCR9)
   04050 Cytokine receptors [BR:hsa04050]
    10803 (CCR9)
   04090 CD molecules [BR:hsa04090]
    10803 (CCR9)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    10803 (CCR9)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   10803 (CCR9)
CD molecules [BR:hsa04090]
 Proteins
  10803 (CCR9)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF621
Other DBs
NCBI-GeneID: 10803
NCBI-ProteinID: NP_112477
OMIM: 604738
HGNC: 1610
Ensembl: ENSG00000173585
Vega: OTTHUMG00000133450
Pharos: P51686(Tchem)
UniProt: P51686
Structure
PDB: 
5LWE

Position
3p21.31
AA seq 369 aa
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFI
VGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCK
VVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALC
IPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHT
LIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
ETTSGALSL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgacacccacagacttcacaagccctattcctaacatggctgatgactatggctctgaa
tccacatcttccatggaagactacgttaacttcaacttcactgacttctactgtgagaaa
aacaatgtcaggcagtttgcgagccatttcctcccacccttgtactggctcgtgttcatc
gtgggtgccttgggcaacagtcttgttatccttgtctactggtactgcacaagagtgaag
accatgaccgacatgttccttttgaatttggcaattgctgacctcctctttcttgtcact
cttcccttctgggccattgctgctgctgaccagtggaagttccagaccttcatgtgcaag
gtggtcaacagcatgtacaagatgaacttctacagctgtgtgttgctgatcatgtgcatc
agcgtggacaggtacattgccattgcccaggccatgagagcacatacttggagggagaaa
aggcttttgtacagcaaaatggtttgctttaccatctgggtattggcagctgctctctgc
atcccagaaatcttatacagccaaatcaaggaggaatccggcattgctatctgcaccatg
gtttaccctagcgatgagagcaccaaactgaagtcagctgtcttgaccctgaaggtcatt
ctggggttcttccttcccttcgtggtcatggcttgctgctataccatcatcattcacacc
ctgatacaagccaagaagtcttccaagcacaaagccctaaaagtgaccatcactgtcctg
accgtctttgtcttgtctcagtttccctacaactgcattttgttggtgcagaccattgac
gcctatgccatgttcatctccaactgtgccgtttccaccaacattgacatctgcttccag
gtcacccagaccatcgccttcttccacagttgcctgaaccctgttctctatgtttttgtg
ggtgagagattccgccgggatctcgtgaaaaccctgaagaacttgggttgcatcagccag
gcccagtgggtttcatttacaaggagagagggaagcttgaagctgtcgtctatgttgctg
gagacaacctcaggagcactctccctctga

KEGG   Homo sapiens (human): 1230
Entry
1230              CDS       T01001                                 

Gene name
CCR1, CD191, CKR-1, CKR1, CMKBR1, HM145, MIP1aR, SCYAR1
Definition
(RefSeq) C-C motif chemokine receptor 1
  KO
K04176  C-C chemokine receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
  Element
N00212  KSHV vCCL2 to CCR signaling pathway
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01170  KSHV vCCL2 to CCR1 signaling
N01171  MOCV1 MC148 to CCR1 signaling
N01172  HHV6A vCCL4a to CCR1 signaling
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1230 (CCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1230 (CCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1230 (CCR1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    1230 (CCR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1230 (CCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1230 (CCR1)
   04050 Cytokine receptors [BR:hsa04050]
    1230 (CCR1)
   04090 CD molecules [BR:hsa04090]
    1230 (CCR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1230 (CCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1230 (CCR1)
CD molecules [BR:hsa04090]
 Proteins
  1230 (CCR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1240
Other DBs
NCBI-GeneID: 1230
NCBI-ProteinID: NP_001286
OMIM: 601159
HGNC: 1602
Ensembl: ENSG00000163823
Vega: OTTHUMG00000133451
Pharos: P32246(Tchem)
UniProt: P32246 Q5U003
Position
3p21.31
AA seq 355 aa
METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggaaactccaaacaccacagaggactatgacacgaccacagagtttgactatggggat
gcaactccgtgccagaaggtgaacgagagggcctttggggcccaactgctgccccctctg
tactccttggtatttgtcattggcctggttggaaacatcctggtggtcctggtccttgtg
caatacaagaggctaaaaaacatgaccagcatctacctcctgaacctggccatttctgac
ctgctcttcctgttcacgcttcccttctggatcgactacaagttgaaggatgactgggtt
tttggtgatgccatgtgtaagatcctctctgggttttattacacaggcttgtacagcgag
atctttttcatcatcctgctgacgattgacaggtacctggccatcgtccacgccgtgttt
gccttgcgggcacggaccgtcacttttggtgtcatcaccagcatcatcatttgggccctg
gccatcttggcttccatgccaggcttatacttttccaagacccaatgggaattcactcac
cacacctgcagccttcactttcctcacgaaagcctacgagagtggaagctgtttcaggct
ctgaaactgaacctctttgggctggtattgcctttgttggtcatgatcatctgctacaca
gggattataaagattctgctaagacgaccaaatgagaagaaatccaaagctgtccgtttg
atttttgtcatcatgatcatcttttttctcttttggaccccctacaatttgactatactt
atttctgttttccaagacttcctgttcacccatgagtgtgagcagagcagacatttggac
ctggctgtgcaagtgacggaggtgatcgcctacacgcactgctgtgtcaacccagtgatc
tacgccttcgttggtgagaggttccggaagtacctgcggcagttgttccacaggcgtgtg
gctgtgcacctggttaaatggctccccttcctctccgtggacaggctggagagggtcagc
tccacatctccctccacaggggagcatgaactctctgctgggttctga

KEGG   Homo sapiens (human): 1232
Entry
1232              CDS       T01001                                 

Gene name
CCR3, C_C_CKR3, CC-CKR-3, CD193, CKR_3, CKR3, CMKBR3
Definition
(RefSeq) C-C motif chemokine receptor 3
  KO
K04178  C-C chemokine receptor type 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00462  KSHV vCCL1/2/3 to CCR signaling pathway
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01189  KSHV vCCL2 to CCR3 signaling
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1232 (CCR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1232 (CCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1232 (CCR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1232 (CCR3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    1232 (CCR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1232 (CCR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1232 (CCR3)
   04050 Cytokine receptors [BR:hsa04050]
    1232 (CCR3)
   04090 CD molecules [BR:hsa04090]
    1232 (CCR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1232 (CCR3)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1232 (CCR3)
CD molecules [BR:hsa04090]
 Proteins
  1232 (CCR3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF3112
Other DBs
NCBI-GeneID: 1232
NCBI-ProteinID: NP_001828
OMIM: 601268
HGNC: 1604
Ensembl: ENSG00000183625
Vega: OTTHUMG00000133484
Pharos: P51677(Tchem)
UniProt: P51677 Q8TDP5 A1LPE5
Position
3p21.31
AA seq 355 aa
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgacaacctcactagatacagttgagacctttggtaccacatcctactatgatgacgtg
ggcctgctctgtgaaaaagctgataccagagcactgatggcccagtttgtgcccccgctg
tactccctggtgttcactgtgggcctcttgggcaatgtggtggtggtgatgatcctcata
aaatacaggaggctccgaattatgaccaacatctacctgctcaacctggccatttcggac
ctgctcttcctcgtcacccttccattctggatccactatgtcagggggcataactgggtt
tttggccatggcatgtgtaagctcctctcagggttttatcacacaggcttgtacagcgag
atctttttcataatcctgctgacaatcgacaggtacctggccattgtccatgctgtgttt
gcccttcgagcccggactgtcacttttggtgtcatcaccagcatcgtcacctggggcctg
gcagtgctagcagctcttcctgaatttatcttctatgagactgaagagttgtttgaagag
actctttgcagtgctctttacccagaggatacagtatatagctggaggcatttccacact
ctgagaatgaccatcttctgtctcgttctccctctgctcgttatggccatctgctacaca
ggaatcatcaaaacgctgctgaggtgccccagtaaaaaaaagtacaaggccatccggctc
atttttgtcatcatggcggtgtttttcattttctggacaccctacaatgtggctatcctt
ctctcttcctatcaatccatcttatttggaaatgactgtgagcggagcaagcatctggac
ctggtcatgctggtgacagaggtgatcgcctactcccactgctgcatgaacccggtgatc
tacgcctttgttggagagaggttccggaagtacctgcgccacttcttccacaggcacttg
ctcatgcacctgggcagatacatcccattccttcctagtgagaagctggaaagaaccagc
tctgtctctccatccacagcagagccggaactctctattgtgttttag

KEGG   Homo sapiens (human): 1233
Entry
1233              CDS       T01001                                 

Gene name
CCR4, CC-CKR-4, CD194, CKR4, CMKBR4, ChemR13, HGCN:14099, K5-5
Definition
(RefSeq) C-C motif chemokine receptor 4
  KO
K04179  C-C chemokine receptor type 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00462  KSHV vCCL1/2/3 to CCR signaling pathway
N01190  CCL5/17/22 to CCR4 signaling
N01191  HHV6A vCCL4a to CCR4 signaling
N01195  KSHV vCCL3 to CCR4 signaling
Drug target
Mogamulizumab: D09761<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1233 (CCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1233 (CCR4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1233 (CCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1233 (CCR4)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    1233 (CCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1233 (CCR4)
   04050 Cytokine receptors [BR:hsa04050]
    1233 (CCR4)
   04090 CD molecules [BR:hsa04090]
    1233 (CCR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1233 (CCR4)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1233 (CCR4)
CD molecules [BR:hsa04090]
 Proteins
  1233 (CCR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 1233
NCBI-ProteinID: NP_005499
OMIM: 604836
HGNC: 1605
Ensembl: ENSG00000183813
Vega: OTTHUMG00000130752
Pharos: P51679(Tclin)
UniProt: P51679 A0N0Q1
Position
3p22.3
AA seq 360 aa
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVV
VLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVG
FYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYT
ERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKA
VKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN
PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaaccccacggatatagcagacaccaccctcgatgaaagcatatacagcaattactat
ctgtatgaaagtatccccaagccttgcaccaaagaaggcatcaaggcatttggggagctc
ttcctgcccccactgtattccttggtttttgtatttggtctgcttggaaattctgtggtg
gttctggtcctgttcaaatacaagcggctcaggtccatgactgatgtgtacctgctcaac
cttgccatctcggatctgctcttcgtgttttccctccctttttggggctactatgcagca
gaccagtgggtttttgggctaggtctgtgcaagatgatttcctggatgtacttggtgggc
ttttacagtggcatattctttgtcatgctcatgagcattgatagatacctggcaattgtg
cacgcggtgttttccttgagggcaaggaccttgacttatggggtcatcaccagtttggct
acatggtcagtggctgtgttcgcctcccttcctggctttctgttcagcacttgttatact
gagcgcaaccatacctactgcaaaaccaagtactctctcaactccacgacgtggaaggtt
ctcagctccctggaaatcaacattctcggattggtgatccccttagggatcatgctgttt
tgctactccatgatcatcaggaccttgcagcattgtaaaaatgagaagaagaacaaggcg
gtgaagatgatctttgccgtggtggtcctcttccttgggttctggacaccttacaacata
gtgctcttcctagagaccctggtggagctagaagtccttcaggactgcacctttgaaaga
tacttggactatgccatccaggccacagaaactctggcttttgttcactgctgccttaat
cccatcatctacttttttctgggggagaaatttcgcaagtacatcctacagctcttcaaa
acctgcaggggcctttttgtgctctgccaatactgtgggctcctccaaatttactctgct
gacacccccagctcatcttacacgcagtccaccatggatcatgatctccatgatgctctg
tag

KEGG   Homo sapiens (human): 1234
Entry
1234              CDS       T01001                                 

Gene name
CCR5, CC-CKR-5, CCCKR5, CCR-5, CD195, CKR-5, CKR5, CMKBR5, IDDM22
Definition
(RefSeq) C-C motif chemokine receptor 5
  KO
K04180  C-C chemokine receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa05145  Toxoplasmosis
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00212  KSHV vCCL2 to CCR signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00431  HIV gp120 to CXCR4-GNAI-PI3K-BAD signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
N01196  CCL3/4/5/8 to CCR5 signaling
N01206  KSHV vCCL2 to CCR5 signaling
N01208  MOCV1 MC148 to CCR5 signaling
N01209  HHV6A vCCL4a to CCR5 signaling
N01210  KSHV vCCL1 to CCR5 signaling
N01211  HIV gp120 to CCR5 signaling
Disease
H01360  Allergic rhinitis
Drug target
Ancriviroc: D03210
Aplaviroc hydrochloride: D06557
Cenicriviroc (DG01264): D09878 D09879
Leronlimab: D11399
Maraviroc: D06670<JP/US>
Vicriviroc maleate: D06297
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1234 (CCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1234 (CCR5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1234 (CCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1234 (CCR5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1234 (CCR5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1234 (CCR5)
   05163 Human cytomegalovirus infection
    1234 (CCR5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1234 (CCR5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    1234 (CCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1234 (CCR5)
   04050 Cytokine receptors [BR:hsa04050]
    1234 (CCR5)
   04090 CD molecules [BR:hsa04090]
    1234 (CCR5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1234 (CCR5)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1234 (CCR5)
CD molecules [BR:hsa04090]
 Proteins
  1234 (CCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx T4SS_pilin
Other DBs
NCBI-GeneID: 1234
NCBI-ProteinID: NP_000570
OMIM: 601373
HGNC: 1606
Ensembl: ENSG00000160791
Vega: OTTHUMG00000133481
Pharos: P51681(Tclin)
UniProt: P51681 Q38L21
Structure
PDB: 
6MEO 6MET 6FGP 2L87

Position
3p21.31
AA seq 352 aa
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggattatcaagtgtcaagtccaatctatgacatcaattattatacatcggagccctgc
caaaaaatcaatgtgaagcaaatcgcagcccgcctcctgcctccgctctactcactggtg
ttcatctttggttttgtgggcaacatgctggtcatcctcatcctgataaactgcaaaagg
ctgaagagcatgactgacatctacctgctcaacctggccatctctgacctgtttttcctt
cttactgtccccttctgggctcactatgctgccgcccagtgggactttggaaatacaatg
tgtcaactcttgacagggctctattttataggcttcttctctggaatcttcttcatcatc
ctcctgacaatcgataggtacctggctgtcgtccatgctgtgtttgctttaaaagccagg
acggtcacctttggggtggtgacaagtgtgatcacttgggtggtggctgtgtttgcgtct
ctcccaggaatcatctttaccagatctcaaaaagaaggtcttcattacacctgcagctct
cattttccatacagtcagtatcaattctggaagaatttccagacattaaagatagtcatc
ttggggctggtcctgccgctgcttgtcatggtcatctgctactcgggaatcctaaaaact
ctgcttcggtgtcgaaatgagaagaagaggcacagggctgtgaggcttatcttcaccatc
atgattgtttattttctcttctgggctccctacaacattgtccttctcctgaacaccttc
caggaattctttggcctgaataattgcagtagctctaacaggttggaccaagctatgcag
gtgacagagactcttgggatgacgcactgctgcatcaaccccatcatctatgcctttgtc
ggggagaagttcagaaactacctcttagtcttcttccaaaagcacattgccaaacgcttc
tgcaaatgctgttctattttccagcaagaggctcccgagcgagcaagctcagtttacacc
cgatccactggggagcaggaaatatctgtgggcttgtga

KEGG   Homo sapiens (human): 1235
Entry
1235              CDS       T01001                                 

Gene name
CCR6, BN-1, C-C_CKR-6, CC-CKR-6, CCR-6, CD196, CKR-L3, CKRL3, CMKBR6, DCR2, DRY6, GPR29, GPRCY4, STRL22
Definition
(RefSeq) C-C motif chemokine receptor 6
  KO
K04181  C-C chemokine receptor type 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01213  CCL20 to CCR6 signaling
N01214  HHV6A vCCL4a to CCR6 signaling
Disease
H01492  Systemic sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1235 (CCR6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1235 (CCR6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1235 (CCR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1235 (CCR6)
   04050 Cytokine receptors [BR:hsa04050]
    1235 (CCR6)
   04090 CD molecules [BR:hsa04090]
    1235 (CCR6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1235 (CCR6)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1235 (CCR6)
CD molecules [BR:hsa04090]
 Proteins
  1235 (CCR6)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 1235
NCBI-ProteinID: NP_004358
OMIM: 601835
HGNC: 1607
Ensembl: ENSG00000112486
Vega: OTTHUMG00000016015
Pharos: P51684(Tbio)
UniProt: P51684
Position
6q27
AA seq 374 aa
MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFG
LLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKL
LKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISS
STFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKT
LVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAANLGKMNRSCQSEKLIGYTKTV
TEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQT
SETADNDNASSFTM
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgagcggggaatcaatgaatttcagcgatgttttcgactccagtgaagattattttgtg
tcagtcaatacttcatattactcagttgattctgagatgttactgtgctccttgcaggag
gtcaggcagttctccaggctatttgtaccgattgcctactccttgatctgtgtctttggc
ctcctggggaatattctggtggtgatcacctttgctttttataagaaggccaggtctatg
acagacgtctatctcttgaacatggccattgcagacatcctctttgttcttactctccca
ttctgggcagtgagtcatgccaccggtgcgtgggttttcagcaatgccacgtgcaagttg
ctaaaaggcatctatgccatcaactttaactgcgggatgctgctcctgacttgcattagc
atggaccggtacatcgccattgtacaggcgactaagtcattccggctccgatccagaaca
ctaccgcgcagcaaaatcatctgccttgttgtgtgggggctgtcagtcatcatctccagc
tcaacttttgtcttcaaccaaaaatacaacacccaaggcagcgatgtctgtgaacccaag
taccagactgtctcggagcccatcaggtggaagctgctgatgttggggcttgagctactc
tttggtttctttatccctttgatgttcatgatattttgttacacgttcattgtcaaaacc
ttggtgcaagctcagaattctaaaaggcacaaagccatccgtgtaatcatagctgtggtg
cttgtgtttctggcttgtcagattcctcataacatggtcctgcttgtgacggctgcaaat
ttgggtaaaatgaaccgatcctgccagagcgaaaagctaattggctatacgaaaactgtc
acagaagtcctggctttcctgcactgctgcctgaaccctgtgctctacgcttttattggg
cagaagttcagaaactactttctgaagatcttgaaggacctgtggtgtgtgagaaggaag
tacaagtcctcaggcttctcctgtgccgggaggtactcagaaaacatttctcggcagacc
agtgagaccgcagataacgacaatgcgtcgtccttcactatgtga

KEGG   Homo sapiens (human): 1236
Entry
1236              CDS       T01001                                 

Gene name
CCR7, BLR2, CC-CKR-7, CCR-7, CD197, CDw197, CMKBR7, EBI1
Definition
(RefSeq) C-C motif chemokine receptor 7
  KO
K04182  C-C chemokine receptor type 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01229  CCL19/21 to CCR7/11 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1236 (CCR7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1236 (CCR7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1236 (CCR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1236 (CCR7)
   04050 Cytokine receptors [BR:hsa04050]
    1236 (CCR7)
   04090 CD molecules [BR:hsa04090]
    1236 (CCR7)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1236 (CCR7)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1236 (CCR7)
CD molecules [BR:hsa04090]
 Proteins
  1236 (CCR7)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF621
Other DBs
NCBI-GeneID: 1236
NCBI-ProteinID: NP_001829
OMIM: 600242
HGNC: 1608
Ensembl: ENSG00000126353
Vega: OTTHUMG00000133375
Pharos: P32248(Tbio)
UniProt: P32248 A0N0Q0
Position
17q21.2
AA seq 378 aa
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWF
LPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK
SWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
GIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMS
FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL
SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRH
IRRSSMSVEAETTTTFSP
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggacctggggaaaccaatgaaaagcgtgctggtggtggctctccttgtcattttccag
gtatgcctgtgtcaagatgaggtcacggacgattacatcggagacaacaccacagtggac
tacactttgttcgagtctttgtgctccaagaaggacgtgcggaactttaaagcctggttc
ctccctatcatgtactccatcatttgtttcgtgggcctactgggcaatgggctggtcgtg
ttgacctatatctatttcaagaggctcaagaccatgaccgatacctacctgctcaacctg
gcggtggcagacatcctcttcctcctgacccttcccttctgggcctacagcgcggccaag
tcctgggtcttcggtgtccacttttgcaagctcatctttgccatctacaagatgagcttc
ttcagtggcatgctcctacttctttgcatcagcattgaccgctacgtggccatcgtccag
gctgtctcagctcaccgccaccgtgcccgcgtccttctcatcagcaagctgtcctgtgtg
ggcatctggatactagccacagtgctctccatcccagagctcctgtacagtgacctccag
aggagcagcagtgagcaagcgatgcgatgctctctcatcacagagcatgtggaggccttt
atcaccatccaggtggcccagatggtgatcggctttctggtccccctgctggccatgagc
ttctgttaccttgtcatcatccgcaccctgctccaggcacgcaactttgagcgcaacaag
gccatcaaggtgatcatcgctgtggtcgtggtcttcatagtcttccagctgccctacaat
ggggtggtcctggcccagacggtggccaacttcaacatcaccagtagcacctgtgagctc
agtaagcaactcaacatcgcctacgacgtcacctacagcctggcctgcgtccgctgctgc
gtcaaccctttcttgtacgccttcatcggcgtcaagttccgcaacgatctcttcaagctc
ttcaaggacctgggctgcctcagccaggagcagctccggcagtggtcttcctgtcggcac
atccggcgctcctccatgagtgtggaggccgagaccaccaccaccttctccccatag

KEGG   Homo sapiens (human): 1237
Entry
1237              CDS       T01001                                 

Gene name
CCR8, CC-CKR-8, CCR-8, CDw198, CKRL1, CMKBR8, CMKBRL2, CY6, GPRCY6, TER1
Definition
(RefSeq) C-C motif chemokine receptor 8
  KO
K04183  C-C chemokine receptor type 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00462  KSHV vCCL1/2/3 to CCR signaling pathway
N01215  CCL1 to CCR8 signaling
N01216  MOCV1 MC148 to CCR8 signaling
N01217  HHV6A vCCL4a to CCR8 signaling
N01220  KSHV vCCL1/2 to CCR8 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1237 (CCR8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1237 (CCR8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1237 (CCR8)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1237 (CCR8)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    1237 (CCR8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1237 (CCR8)
   04050 Cytokine receptors [BR:hsa04050]
    1237 (CCR8)
   04090 CD molecules [BR:hsa04090]
    1237 (CCR8)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1237 (CCR8)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1237 (CCR8)
CD molecules [BR:hsa04090]
 Proteins
  1237 (CCR8)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 1237
NCBI-ProteinID: NP_005192
OMIM: 601834
HGNC: 1609
Ensembl: ENSG00000179934
Vega: OTTHUMG00000131290
Pharos: P51685(Tchem)
UniProt: P51685
Position
3p22.1
AA seq 355 aa
MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL
VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS
MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV
LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV
LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY
AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggattatacacttgacctcagtgtgacaacagtgaccgactactactaccctgatatc
ttctcaagcccctgtgatgcggaacttattcagacaaatggcaagttgctccttgctgtc
ttttattgcctcctgtttgtattcagtcttctgggaaacagcctggtcatcctggtcctt
gtggtctgcaagaagctgaggagcatcacagatgtatacctcttgaacctggccctgtct
gacctgctttttgtcttctccttcccctttcagacctactatctgctggaccagtgggtg
tttgggactgtaatgtgcaaagtggtgtctggcttttattacattggcttctacagcagc
atgtttttcatcaccctcatgagtgtggacaggtacctggctgttgtccatgccgtgtat
gccctaaaggtgaggacgatcaggatgggcacaacgctgtgcctggcagtatggctaacc
gccattatggctaccatcccattgctagtgttttaccaagtggcctctgaagatggtgtt
ctacagtgttattcattttacaatcaacagactttgaagtggaagatcttcaccaacttc
aaaatgaacattttaggcttgttgatcccattcaccatctttatgttctgctacattaaa
atcctgcaccagctgaagaggtgtcaaaaccacaacaagaccaaggccatcaggttggtg
ctcattgtggtcattgcatctttacttttctgggtcccattcaacgtggttcttttcctc
acttccttgcacagtatgcacatcttggatggatgtagcataagccaacagctgacttat
gccacccatgtcacagaaatcatttcctttactcactgctgtgtgaaccctgttatctat
gcttttgttggggagaagttcaagaaacacctctcagaaatatttcagaaaagttgcagc
caaatcttcaactacctaggaagacaaatgcctagggagagctgtgaaaagtcatcatcc
tgccagcagcactcctcccgttcctccagcgtagactacattttgtga

KEGG   Homo sapiens (human): 1524
Entry
1524              CDS       T01001                                 

Gene name
CX3CR1, CCRL1, CMKBRL1, CMKDR1, GPR13, GPRV28, V28
Definition
(RefSeq) C-X3-C motif chemokine receptor 1
  KO
K04192  CX3C chemokine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N01263  KSHV vCCL2 to CX3CR1 signaling
N01264  HCMV vCXCL1 to CX3CR1 signaling
Disease
H00821  Age-related macular degeneration
H01742  Coronary artery disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1524 (CX3CR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1524 (CX3CR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1524 (CX3CR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1524 (CX3CR1)
   04050 Cytokine receptors [BR:hsa04050]
    1524 (CX3CR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CX3C Chemokine
    1524 (CX3CR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CX3C Chemokine
   1524 (CX3CR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 1524
NCBI-ProteinID: NP_001164642
OMIM: 601470
HGNC: 2558
Ensembl: ENSG00000168329
Vega: OTTHUMG00000156249
Pharos: P49238(Tchem)
UniProt: P49238
Position
3p22.2
AA seq 355 aa
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK
KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI
TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP
EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF
FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF
RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggatcagttccctgaatcagtgacagaaaactttgagtacgatgatttggctgaggcc
tgttatattggggacatcgtggtctttgggactgtgttcctgtccatattctactccgtc
atctttgccattggcctggtgggaaatttgttggtagtgtttgccctcaccaacagcaag
aagcccaagagtgtcaccgacatttacctcctgaacctggccttgtctgatctgctgttt
gtagccactttgcccttctggactcactatttgataaatgaaaagggcctccacaatgcc
atgtgcaaattcactaccgccttcttcttcatcggcttttttggaagcatattcttcatc
accgtcatcagcattgataggtacctggccatcgtcctggccgccaactccatgaacaac
cggaccgtgcagcatggcgtcaccatcagcctaggcgtctgggcagcagccattttggtg
gcagcaccccagttcatgttcacaaagcagaaagaaaatgaatgccttggtgactacccc
gaggtcctccaggaaatctggcccgtgctccgcaatgtggaaacaaattttcttggcttc
ctactccccctgctcattatgagttattgctacttcagaatcatccagacgctgttttcc
tgcaagaaccacaagaaagccaaagccattaaactgatccttctggtggtcatcgtgttt
ttcctcttctggacaccctacaacgttatgattttcctggagacgcttaagctctatgac
ttctttcccagttgtgacatgaggaaggatctgaggctggccctcagtgtgactgagacg
gttgcatttagccattgttgcctgaatcctctcatctatgcatttgctggggagaagttc
agaagatacctttaccacctgtatgggaaatgcctggctgtcctgtgtgggcgctcagtc
cacgttgatttctcctcatctgaatcacaaaggagcaggcatggaagtgttctgagcagc
aattttacttaccacacgagtgatggagatgcattgctccttctctga

KEGG   Homo sapiens (human): 2826
Entry
2826              CDS       T01001                                 

Gene name
CCR10, GPR2
Definition
(RefSeq) C-C motif chemokine receptor 10
  KO
K04185  C-C chemokine receptor type 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01225  CCL27/28 to CCR10 signaling
N01226  KSHV vCCL2 to CCR10 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2826 (CCR10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2826 (CCR10)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    2826 (CCR10)
   04062 Chemokine signaling pathway
    2826 (CCR10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2826 (CCR10)
   04050 Cytokine receptors [BR:hsa04050]
    2826 (CCR10)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    2826 (CCR10)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   2826 (CCR10)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 2826
NCBI-ProteinID: NP_057686
OMIM: 600240
HGNC: 4474
Ensembl: ENSG00000184451
Vega: OTTHUMG00000132301
Pharos: P46092(Tbio)
UniProt: P46092
Position
17q21.2
AA seq 362 aa
MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNG
LVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLY
SASFHAGFLFLACISADRYVAIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFS
QDGQREGQRRCRLIFPEGLTQTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGP
ERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLAL
ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCSAPTETHSLSW
DN
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggggacggaggccacagagcaggtttcctggggccattactctggggatgaagaggac
gcatactcggctgagccactgccggagctttgctacaaggccgatgtccaggccttcagc
cgggccttccaacccagtgtctccctgaccgtggctgcgctgggtctggccggcaatggc
ctggtcctggccacccacctggcagcccgacgcgcagcgcgctcgcccacctctgcccac
ctgctccagctggccctggccgacctcttgctggccctgactctgcccttcgcggcagca
ggggctcttcagggctggagtctgggaagtgccacctgccgcaccatctctggcctctac
tcggcctccttccacgccggcttcctcttcctggcctgtatcagcgccgaccgctacgtg
gccatcgcgcgagcgctcccagccgggccgcggccctccactcccggccgcgcacacttg
gtctccgtcatcgtgtggctgctgtcactgctcctggcgctgcctgcgctgctcttcagc
caggatgggcagcgggaaggccaacgacgctgtcgcctcatcttccccgagggcctcacg
cagacggtgaagggggcgagcgccgtggcgcaggtggccctgggcttcgcgctgccgctg
ggcgtcatggtagcctgctacgcgcttctgggccgcacgctgctggccgccagggggccc
gagcgccggcgtgcgctgcgcgtcgtggtggctctggtggcggccttcgtggtgctgcag
ctgccctacagcctcgccctgctgctggatactgccgatctactggctgcgcgcgagcgg
agctgccctgccagcaaacgcaaggatgtcgcactgctggtgaccagcggcttggccctc
gcccgctgtggcctcaatcccgttctctacgccttcctgggcctgcgcttccgccaggac
ctgcggaggctgctacggggtgggagctgcccctcagggcctcaaccccgccgcggctgc
ccccgccggccccgcctttcttcctgctcagctcccacggagacccacagtctctcctgg
gacaactag

KEGG   Homo sapiens (human): 2829
Entry
2829              CDS       T01001                                 

Gene name
XCR1, CCXCR1, GPR5
Definition
(RefSeq) X-C motif chemokine receptor 1
  KO
K04193  XC chemokine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01258  XCL to XCR1 signaling
N01260  KSHV vCCL2 to XCR1 signaling
N01261  KSHV vCCL3 to XCR1 signaling
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2829 (XCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2829 (XCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2829 (XCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2829 (XCR1)
   04050 Cytokine receptors [BR:hsa04050]
    2829 (XCR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   C Chemokine
    2829 (XCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  C Chemokine
   2829 (XCR1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 2829
NCBI-ProteinID: NP_001019815
OMIM: 600552
HGNC: 1625
Ensembl: ENSG00000173578
Vega: OTTHUMG00000133449
Pharos: P46094(Tbio)
UniProt: P46094 Q689E2 Q502V0
Position
3p21.31
AA seq 333 aa
MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYE
SLESLTNIFILNLCLSDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFL
TIMTIHRYLSVVSPLSTLRVPTLRCRVLVTMAVWVASILSSILDTIFHKVLSSGCDYSEL
TWYLTSVYQHNLFFLLSLGIILFCYVEILRTLFRSRSKRRHRTVKLIFAIVVAYFLSWGP
YNFTLFLQTLFRTQIIRSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKH
VLRQFWFCRLQAPSPASIPHSPGAFAYEGASFY
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggagtcctcaggcaacccagagagcaccacctttttttactatgaccttcagagccag
ccgtgtgagaaccaggcctgggtctttgctaccctcgccaccactgtcctatactgcctg
gtgtttctcctcagcctagtgggcaacagcctggtcctgtgggtcctggtgaagtatgag
agcctggagtccctcaccaacatcttcatcctcaacctgtgcctctcagacctggtgttc
gcctgcttgttgcctgtgtggatctccccataccactggggctgggtgctgggagacttc
ctctgcaaactcctcaatatgatcttctccatcagcctctacagcagcatcttcttcctg
accatcatgaccatccaccgctacctgtcggtagtgagccccctctccaccctgcgcgtc
cccaccctccgctgccgggtgctggtgaccatggctgtgtgggtagccagcatcctgtcc
tccatcctcgacaccatcttccacaaggtgctttcttcgggctgtgattattccgaactc
acgtggtacctcacctccgtctaccagcacaacctcttcttcctgctgtccctggggatt
atcctgttctgctacgtggagatcctcaggaccctgttccgctcacgctccaagcggcgc
caccgcacggtcaagctcatcttcgccatcgtggtggcctacttcctcagctggggtccc
tacaacttcaccctgtttctgcagacgctgtttcggacccagatcatccggagctgcgag
gccaaacagcagctagaatacgccctgctcatctgccgcaacctcgccttctcccactgc
tgctttaacccggtgctctatgtcttcgtgggggtcaagttccgcacacacctgaaacat
gttctccggcagttctggttctgccggctgcaggcacccagcccagcctcgatcccccac
tcccctggtgccttcgcctatgagggcgcctccttctactga

KEGG   Homo sapiens (human): 2833
Entry
2833              CDS       T01001                                 

Gene name
CXCR3, CD182, CD183, CKR-L2, CMKAR3, GPR9, IP10-R, Mig-R, MigR
Definition
(RefSeq) C-X-C motif chemokine receptor 3
  KO
K04188  C-X-C chemokine receptor type 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01241  CXCL4/9/10/11/13 to CXCR3/5 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2833 (CXCR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2833 (CXCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2833 (CXCR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2833 (CXCR3)
   04050 Cytokine receptors [BR:hsa04050]
    2833 (CXCR3)
   04090 CD molecules [BR:hsa04090]
    2833 (CXCR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    2833 (CXCR3)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   2833 (CXCR3)
CD molecules [BR:hsa04090]
 Proteins
  2833 (CXCR3)
SSDB
Motif
Pfam: 7tm_1 Ctr 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 2833
NCBI-ProteinID: NP_001495
OMIM: 300574
HGNC: 4540
Ensembl: ENSG00000186810
Vega: OTTHUMG00000033326
Pharos: P49682(Tchem)
UniProt: P49682
Position
Xq13.1
AA seq 368 aa
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
SEASYSGL
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggtccttgaggtgagtgaccaccaagtgctaaatgacgccgaggttgccgccctcctg
gagaacttcagctcttcctatgactatggagaaaacgagagtgactcgtgctgtacctcc
ccgccctgcccacaggacttcagcctgaacttcgaccgggccttcctgccagccctctac
agcctcctctttctgctggggctgctgggcaacggcgcggtggcagccgtgctgctgagc
cggcggacagccctgagcagcaccgacaccttcctgctccacctagctgtagcagacacg
ctgctggtgctgacactgccgctctgggcagtggacgctgccgtccagtgggtctttggc
tctggcctctgcaaagtggcaggtgccctcttcaacatcaacttctacgcaggagccctc
ctgctggcctgcatcagctttgaccgctacctgaacatagttcatgccacccagctctac
cgccgggggcccccggcccgcgtgaccctcacctgcctggctgtctgggggctctgcctg
cttttcgccctcccagacttcatcttcctgtcggcccaccacgacgagcgcctcaacgcc
acccactgccaatacaacttcccacaggtgggccgcacggctctgcgggtgctgcagctg
gtggctggctttctgctgcccctgctggtcatggcctactgctatgcccacatcctggcc
gtgctgctggtttccaggggccagcggcgcctgcgggccatgcggctggtggtggtggtc
gtggtggcctttgccctctgctggaccccctatcacctggtggtgctggtggacatcctc
atggacctgggcgctttggcccgcaactgtggccgagaaagcagggtagacgtggccaag
tcggtcacctcaggcctgggctacatgcactgctgcctcaacccgctgctctatgccttt
gtaggggtcaagttccgggagcggatgtggatgctgctcttgcgcctgggctgccccaac
cagagagggctccagaggcagccatcgtcttcccgccgggattcatcctggtctgagacc
tcagaggcctcctactcgggcttgtga

KEGG   Homo sapiens (human): 3577
Entry
3577              CDS       T01001                                 

Gene name
CXCR1, C-C, C-C-CKR-1, CD128, CD181, CDw128a, CKR-1, CMKAR1, IL8R1, IL8RA, IL8RBA
Definition
(RefSeq) C-X-C motif chemokine receptor 1
  KO
K04175  C-X-C chemokine receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01233  CXCL1/5/6/8 to CXCR1 signaling
N01236  MOCV1 MC148 to CXCR1 signaling
N01237  HCMV vCXCL1 to CXCR1 signaling
Drug target
Navarixin: D10075
Reparixin: D08984
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    3577 (CXCR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3577 (CXCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3577 (CXCR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3577 (CXCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    3577 (CXCR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3577 (CXCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3577 (CXCR1)
   04050 Cytokine receptors [BR:hsa04050]
    3577 (CXCR1)
   04090 CD molecules [BR:hsa04090]
    3577 (CXCR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    3577 (CXCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   3577 (CXCR1)
CD molecules [BR:hsa04090]
 Proteins
  3577 (CXCR1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 3577
NCBI-ProteinID: NP_000625
OMIM: 146929
HGNC: 6026
Ensembl: ENSG00000163464
Vega: OTTHUMG00000133108
Pharos: P25024(Tchem)
UniProt: P25024
Structure
PDB: 
2LNL

Position
2q35
AA seq 350 aa
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatg
ccacctgcagatgaagattacagcccctgtatgctagaaactgagacactcaacaagtat
gttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtg
atgctggtcatcttatacagcagggtcggccgctccgtcactgatgtctacctgctgaac
ctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtg
aatggctggatttttggcacattcctgtgcaaggtggtctcactcctgaaggaagtcaac
ttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtc
catgccacacgcacactgacccagaagcgtcacttggtcaagtttgtttgtcttggctgc
tggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatcca
aacaattccagtccagtttgctatgaggtcctgggaaatgacacagcaaaatggcggatg
gtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttc
tgctatggattcaccctgcgtacactgtttaaggcccacatggggcagaagcaccgagcc
atgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacctg
gtcctgctggcagacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgc
aacaacatcggccgggccctggatgccactgagattctgggatttctccatagctgcctc
aaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctg
gctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtgttacctcctacact
tcttcgtctgtcaatgtctcttccaacctctga

KEGG   Homo sapiens (human): 3579
Entry
3579              CDS       T01001                                 

Gene name
CXCR2, CD182, CDw128b, CMKAR2, IL8R2, IL8RA, IL8RB
Definition
(RefSeq) C-X-C motif chemokine receptor 2
  KO
K05050  C-X-C chemokine receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05163  Human cytomegalovirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00427  HCMV vCXCL to CXCR-GNB/G-PI3K-AKT signaling pathway
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
N01240  MOCV1 MC148 to CXCR2 signaling
Drug target
Danirixin: D10387
Elubrixin (DG01371): D10332 D10420
Navarixin: D10075
Reparixin: D08984
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    3579 (CXCR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3579 (CXCR2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3579 (CXCR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3579 (CXCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    3579 (CXCR2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3579 (CXCR2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    3579 (CXCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3579 (CXCR2)
   04050 Cytokine receptors [BR:hsa04050]
    3579 (CXCR2)
   04090 CD molecules [BR:hsa04090]
    3579 (CXCR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    3579 (CXCR2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   3579 (CXCR2)
CD molecules [BR:hsa04090]
 Proteins
  3579 (CXCR2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 3579
NCBI-ProteinID: NP_001161770
OMIM: 146928
HGNC: 6027
Ensembl: ENSG00000180871
Vega: OTTHUMG00000133107
Pharos: P25025(Tchem)
UniProt: P25025 Q53PC4
Position
2q35
AA seq 360 aa
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaagattttaacatggagagtgacagctttgaagatttctggaaaggtgaagatctt
agtaattacagttacagctctaccctgcccccttttctactagatgccgccccatgtgaa
ccagaatccctggaaatcaacaagtattttgtggtcattatctatgccctggtattcctg
ctgagcctgctgggaaactccctcgtgatgctggtcatcttatacagcagggtcggccgc
tccgtcactgatgtctacctgctgaacctagccttggccgacctactctttgccctgacc
ttgcccatctgggccgcctccaaggtgaatggctggatttttggcacattcctgtgcaag
gtggtctcactcctgaaggaagtcaacttctatagtggcatcctgctactggcctgcatc
agtgtggaccgttacctggccattgtccatgccacacgcacactgacccagaagcgctac
ttggtcaaattcatatgtctcagcatctggggtctgtccttgctcctggccctgcctgtc
ttacttttccgaaggaccgtctactcatccaatgttagcccagcctgctatgaggacatg
ggcaacaatacagcaaactggcggatgctgttacggatcctgccccagtcctttggcttc
atcgtgccactgctgatcatgctgttctgctacggattcaccctgcgtacgctgtttaag
gcccacatggggcagaagcaccgggccatgcgggtcatctttgctgtcgtcctcatcttc
ctgctctgctggctgccctacaacctggtcctgctggcagacaccctcatgaggacccag
gtgatccaggagacctgtgagcgccgcaatcacatcgaccgggctctggatgccaccgag
attctgggcatccttcacagctgcctcaaccccctcatctacgccttcattggccagaag
tttcgccatggactcctcaagattctagctatacatggcttgatcagcaaggactccctg
cccaaagacagcaggccttcctttgttggctcttcttcagggcacacttccactactctc
taa

KEGG   Homo sapiens (human): 643
Entry
643               CDS       T01001                                 

Gene name
CXCR5, BLR1, CD185, MDR15
Definition
(RefSeq) C-X-C motif chemokine receptor 5
  KO
K04190  C-X-C chemokine receptor type 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01241  CXCL4/9/10/11/13 to CXCR3/5 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    643 (CXCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    643 (CXCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    643 (CXCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    643 (CXCR5)
   04050 Cytokine receptors [BR:hsa04050]
    643 (CXCR5)
   04090 CD molecules [BR:hsa04090]
    643 (CXCR5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    643 (CXCR5)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   643 (CXCR5)
CD molecules [BR:hsa04090]
 Proteins
  643 (CXCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw DUF4059
Other DBs
NCBI-GeneID: 643
NCBI-ProteinID: NP_001707
OMIM: 601613
HGNC: 1060
Ensembl: ENSG00000160683
Vega: OTTHUMG00000166345
Pharos: P32302(Tbio)
UniProt: P32302 A0N0R2 A8K647 Q2YD84
Position
11q23.3
AA seq 372 aa
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSL
IFLLGVIGNVLVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTF
LCKTVIALHKVNFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLLSIHITCGTIWLVGFLL
ALPEILFAKVSQGHHNNSLPRCTFSQENQAETHAWFTSRFLYHVAGFLLPMLVMGWCYVG
VVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSL
PVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSL
SESENATSLTTF
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaactacccgctaacgctggaaatggacctcgagaacctggaggacctgttctgggaa
ctggacagattggacaactataacgacacctccctggtggaaaatcatctctgccctgcc
acagaggggcccctcatggcctccttcaaggccgtgttcgtgcccgtggcctacagcctc
atcttcctcctgggcgtgatcggcaacgtcctggtgctggtgatcctggagcggcaccgg
cagacacgcagttccacggagaccttcctgttccacctggccgtggccgacctcctgctg
gtcttcatcttgccctttgccgtggccgagggctctgtgggctgggtcctggggaccttc
ctctgcaaaactgtgattgccctgcacaaagtcaacttctactgcagcagcctgctcctg
gcctgcatcgccgtggaccgctacctggccattgtccacgccgtccatgcctaccgccac
cgccgcctcctctccatccacatcacctgtgggaccatctggctggtgggcttcctcctt
gccttgccagagattctcttcgccaaagtcagccaaggccatcacaacaactccctgcca
cgttgcaccttctcccaagagaaccaagcagaaacgcatgcctggttcacctcccgattc
ctctaccatgtggcgggattcctgctgcccatgctggtgatgggctggtgctacgtgggg
gtagtgcacaggttgcgccaggcccagcggcgccctcagcggcagaaggcagtcagggtg
gccatcctggtgacaagcatcttcttcctctgctggtcaccctaccacatcgtcatcttc
ctggacaccctggcgaggctgaaggccgtggacaatacctgcaagctgaatggctctctc
cccgtggccatcaccatgtgtgagttcctgggcctggcccactgctgcctcaaccccatg
ctctacactttcgccggcgtgaagttccgcagtgacctgtcgcggctcctgacgaagctg
ggctgtaccggccctgcctccctgtgccagctcttccctagctggcgcaggagcagtctc
tctgagtcagagaatgccacctctctcaccacgttctag

KEGG   Homo sapiens (human): 729230
Entry
729230            CDS       T01001                                 

Gene name
CCR2, CC-CKR-2, CCR-2, CCR2A, CCR2B, CD192, CKR2, CKR2A, CKR2B, CMKBR2, MCP-1-R
Definition
(RefSeq) C-C motif chemokine receptor 2
  KO
K04177  C-C chemokine receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01178  KSHV vCCL2 to CCR2 signaling
N01179  MOCV1 MC148 to CCR2 signaling
N01180  HHV6B vCCL4b to CCR2 signaling
Disease
H01360  Allergic rhinitis
Drug target
Cenicriviroc (DG01264): D09878 D09879
Plozalizumab: D10972
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    729230 (CCR2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    729230 (CCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    729230 (CCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    729230 (CCR2)
   04050 Cytokine receptors [BR:hsa04050]
    729230 (CCR2)
   04090 CD molecules [BR:hsa04090]
    729230 (CCR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    729230 (CCR2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   729230 (CCR2)
CD molecules [BR:hsa04090]
 Proteins
  729230 (CCR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srab
Other DBs
NCBI-GeneID: 729230
NCBI-ProteinID: NP_001116513
OMIM: 601267
HGNC: 1603
Ensembl: ENSG00000121807
Vega: OTTHUMG00000156466
Pharos: P41597(Tchem)
UniProt: P41597
Position
3p21.31
AA seq 374 aa
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY
HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK
CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR
AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI
GRAPEASLQDKEGA
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgctgtccacatctcgttctcggtttatcagaaataccaacgagagcggtgaagaagtc
accaccttttttgattatgattacggtgctccctgtcataaatttgacgtgaagcaaatt
ggggcccaactcctgcctccgctctactcgctggtgttcatctttggttttgtgggcaac
atgctggtcgtcctcatcttaataaactgcaaaaagctgaagtgcttgactgacatttac
ctgctcaacctggccatctctgatctgctttttcttattactctcccattgtgggctcac
tctgctgcaaatgagtgggtctttgggaatgcaatgtgcaaattattcacagggctgtat
cacatcggttattttggcggaatcttcttcatcatcctcctgacaatcgatagatacctg
gctattgtccatgctgtgtttgctttaaaagccaggacggtcacctttggggtggtgaca
agtgtgatcacctggttggtggctgtgtttgcttctgtcccaggaatcatctttactaaa
tgccagaaagaagattctgtttatgtctgtggcccttattttccacgaggatggaataat
ttccacacaataatgaggaacattttggggctggtcctgccgctgctcatcatggtcatc
tgctactcgggaatcctgaaaaccctgcttcggtgtcgaaacgagaagaagaggcatagg
gcagtgagagtcatcttcaccatcatgattgtttactttctcttctggactccctataat
attgtcattctcctgaacaccttccaggaattcttcggcctgagtaactgtgaaagcacc
agtcaactggaccaagccacgcaggtgacagagactcttgggatgactcactgctgcatc
aatcccatcatctatgccttcgttggggagaagttcagaagcctttttcacatagctctt
ggctgtaggattgccccactccaaaaaccagtgtgtggaggtccaggagtgagaccagga
aagaatgtgaaagtgactacacaaggactcctcgatggtcgtggaaaaggaaagtcaatt
ggcagagcccctgaagccagtcttcaggacaaagaaggagcctag

KEGG   Homo sapiens (human): 7852
Entry
7852              CDS       T01001                                 

Gene name
CXCR4, CD184, D2S201E, FB22, HM89, HSY3RR, LAP-3, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM, WHIMS
Definition
(RefSeq) C-X-C motif chemokine receptor 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04670  Leukocyte transendothelial migration
hsa04672  Intestinal immune network for IgA production
hsa04810  Regulation of actin cytoskeleton
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
  Element
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00430  CXCR4-GNAI-PI3K-BAD signaling pathway
N00431  HIV gp120 to CXCR4-GNAI-PI3K-BAD signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00433  CXCR4-GNB/G-RAC signaling pathway
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
N01247  CXCL12 to CXCR4/7 signaling
N01252  KSHV vCCL2 to CXCR4 signaling
N01253  MOCV1 MC148 to CXCR4 signaling
N01254  HIV gp120 to CXCR4 signaling
Disease
H00097  Chemokine receptor defect
Drug target
Mavorixafor: D11510
Plerixafor: D08971<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    7852 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7852 (CXCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    7852 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7852 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    7852 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7852 (CXCR4)
   04672 Intestinal immune network for IgA production
    7852 (CXCR4)
   04062 Chemokine signaling pathway
    7852 (CXCR4)
  09158 Development and regeneration
   04360 Axon guidance
    7852 (CXCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7852 (CXCR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7852 (CXCR4)
   05163 Human cytomegalovirus infection
    7852 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    7852 (CXCR4)
   04050 Cytokine receptors [BR:hsa04050]
    7852 (CXCR4)
   04090 CD molecules [BR:hsa04090]
    7852 (CXCR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    7852 (CXCR4)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   7852 (CXCR4)
CD molecules [BR:hsa04090]
 Proteins
  7852 (CXCR4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx Cybc1_Eros
Other DBs
NCBI-GeneID: 7852
NCBI-ProteinID: NP_003458
OMIM: 162643
HGNC: 2561
Ensembl: ENSG00000121966
Vega: OTTHUMG00000153583
Pharos: P61073(Tclin)
UniProt: P61073
Structure
PDB: 
2N55 2K03 2K04 2K05

Position
2q22.1
AA seq 352 aa
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggaggggatcagtatatacacttcagataactacaccgaggaaatgggctcaggggac
tatgactccatgaaggaaccctgtttccgtgaagaaaatgctaatttcaataaaatcttc
ctgcccaccatctactccatcatcttcttaactggcattgtgggcaatggattggtcatc
ctggtcatgggttaccagaagaaactgagaagcatgacggacaagtacaggctgcacctg
tcagtggccgacctcctctttgtcatcacgcttcccttctgggcagttgatgccgtggca
aactggtactttgggaacttcctatgcaaggcagtccatgtcatctacacagtcaacctc
tacagcagtgtcctcatcctggccttcatcagtctggaccgctacctggccatcgtccac
gccaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtctatgttggcgtc
tggatccctgccctcctgctgactattcccgacttcatctttgccaacgtcagtgaggca
gatgacagatatatctgtgaccgcttctaccccaatgacttgtgggtggttgtgttccag
tttcagcacatcatggttggccttatcctgcctggtattgtcatcctgtcctgctattgc
attatcatctccaagctgtcacactccaagggccaccagaagcgcaaggccctcaagacc
acagtcatcctcatcctggctttcttcgcctgttggctgccttactacattgggatcagc
atcgactccttcatcctcctggaaatcatcaagcaagggtgtgagtttgagaacactgtg
cacaagtggatttccatcaccgaggccctagctttcttccactgttgtctgaaccccatc
ctctatgctttccttggagccaaatttaaaacctctgcccagcacgcactcacctctgtg
agcagagggtccagcctcaagatcctctccaaaggaaagcgaggtggacattcatctgtt
tccactgagtctgagtcttcaagttttcactccagctaa

DBGET integrated database retrieval system