KEGG   Homo sapiens (human): 10664
Entry
10664             CDS       T01001                                 

Gene name
CTCF, CFAP108, FAP108, MRD21
Definition
(RefSeq) CCCTC-binding factor
  KO
K23195  transcriptional repressor CTCF
Organism
hsa  Homo sapiens (human)
Disease
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10664 (CTCF)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10664 (CTCF)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10664 (CTCF)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    10664 (CTCF)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zf-met zf-C2H2_6 zf-C2HE C1_1
Other DBs
NCBI-GeneID: 10664
NCBI-ProteinID: NP_006556
OMIM: 604167
HGNC: 13723
Ensembl: ENSG00000102974
Vega: OTTHUMG00000137539
Pharos: P49711(Tbio)
UniProt: P49711
Structure
PDB: 

Position
16q22.1
AA seq 727 aa
MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQM
VMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPV
PVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQ
GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEV
NAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCG
RAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYAS
VEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY
ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDM
HFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKR
KMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTN
QPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEM
ILSMMDR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggaaggtgatgcagtcgaagccattgtggaggagtccgaaacttttattaaaggaaag
gagagaaagacttaccagagacgccgggaagggggccaggaagaagatgcctgccactta
ccccagaaccagacggatgggggtgaggtggtccaggatgtcaacagcagtgtacagatg
gtgatgatggaacagctggaccccacccttcttcagatgaagactgaagtaatggagggc
acagtggctccagaagcagaggctgctgtggacgatacccagattataactttacaggtt
gtaaatatggaggaacagcccataaacataggagaacttcagcttgttcaagtacctgtt
cctgtgactgtacctgttgctaccacttcagtagaagaacttcagggggcttatgaaaat
gaagtgtctaaagagggccttgcggaaagtgaacccatgatatgccacaccctacctttg
cctgaagggtttcaggtggttaaagtgggggccaatggagaggtggagacactagaacaa
ggggaacttccaccccaggaagatcctagttggcaaaaagacccagactatcagccacca
gccaaaaaaacaaagaaaaccaaaaagagcaaactgcgttatacagaggagggcaaagat
gtagatgtgtctgtctacgattttgaggaagaacagcaggagggtctgctatcagaggtt
aatgcagagaaagtggttggtaatatgaagcctccaaagccaacaaaaattaaaaagaaa
ggtgtaaagaagacattccagtgtgagctttgcagttacacgtgtccacggcgttcaaat
ttggatcgtcacatgaaaagccacactgatgagagaccacacaagtgccatctctgtggc
agggcattcagaacagtcaccctcctgaggaatcaccttaacacacacacaggtactcgt
cctcacaagtgcccagactgcgacatggcctttgtgaccagtggagaattggttcggcat
cgtcgttacaaacacacccacgagaagccattcaagtgttccatgtgcgattacgccagt
gtagaagtcagcaaattaaaacgtcacattcgctctcatactggagagcgtccgtttcag
tgcagtttgtgcagttatgccagcagggacacatacaagctgaaaaggcacatgagaacc
cattcaggggaaaagccttatgaatgttatatttgtcatgctcggtttacccaaagtggt
accatgaagatgcacattttacagaagcacacagaaaatgtggccaaatttcactgtccc
cactgtgacacagtcatagcccgaaaaagtgatttgggtgtccacttgcgaaagcagcat
tcctatattgagcaaggcaagaaatgccgttactgtgatgctgtgtttcatgagcgctat
gccctcatccagcatcagaagtcacacaagaatgagaagcgctttaagtgtgaccagtgt
gattacgcttgtagacaggagaggcacatgatcatgcacaagcgcacccacaccggggag
aagccttacgcctgcagccactgcgataagaccttccgccagaagcagcttctcgacatg
cacttcaagcgctatcacgaccccaacttcgtccctgcggcttttgtctgttctaagtgt
gggaaaacatttacacgtcggaataccatggcaagacatgctgataattgtgctggccca
gatggcgtagagggggaaaatggaggagaaacgaagaagagtaaacgtggaagaaaaaga
aagatgcgctctaagaaagaagattcctctgacagtgaaaatgctgaaccagatctggac
gacaatgaggatgaggaggagcctgccgtagaaattgaacctgagccagagcctcagcct
gtgaccccagccccaccacccgccaagaagcggagaggacgaccccctggcagaaccaac
cagcccaaacagaaccagccaacagctatcattcaggttgaagaccagaatacaggtgca
attgagaacattatagttgaagtaaaaaaagagccagatgctgagcccgcagagggagag
gaagaggaggcccagccagctgccacagatgcccccaacggagacctcacgcccgagatg
atcctcagcatgatggaccggtga

DBGET integrated database retrieval system