KEGG   Homo sapiens (human): 10665
Entry
10665             CDS       T01001                                 
Symbol
TSBP1, C6orf10, TSBP
Name
(RefSeq) testis expressed basic protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 10665
NCBI-ProteinID: NP_006772
OMIM: 618151
HGNC: 13922
Ensembl: ENSG00000204296
Pharos: Q5SRN2(Tdark)
UniProt: Q5SRN2 Q13647
Position
6:complement(32292698..32371903)
AA seq 563 aa
MTVLEITLAVILTLLGLAILAILLTRWARCKQSEMYISRYSSEQSARLLDYEDGRGSRHA
YSTQSDTSYDNRERSKRDYTPSTNSLVSMASKFSLGQTELILLLMCFILALSRSSIGSIK
CLQTTEEPPSRTAGAMMQFTAPIPGATGPIKLSQKTIVQTPGPIVQYPGSNAGPPSAPRG
PPMAPIIISQRTARIPQVHTMDSSGKITLTPVVILTGYMDEELAKKSCSKIQILKCGGTA
RSQNSREENKEALKNDIIFTNSVESLKSAHIKEPEREGKGTDLEKDKIGMEVKVDSDAGI
PKRQETQLKISEMSIPQGQGAQIKKSVSDVPRGQESQVKKSESGVPKGQEAQVTKSGLVV
LKGQEAQVEKSEMGVPRRQESQVKKSQSGVSKGQEAQVKKRESVVLKGQEAQVEKSELKV
PKGQEGQVEKTEADVPKEQEVQEKKSEAGVLKGPESQVKNTEVSVPETLESQVKKSESGV
LKGQEAQEKKESFEDKGNNDKEKERDAEKDPNKKEKGDKNTKGDKGKDKVKGKRESEING
EKSKGSKRAKANTGRKYNKKVEE
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgacagtcttggaaataactttggctgtcatcctgactctactgggacttgccatcctg
gctattttgttaacaagatgggcacgatgtaagcaaagtgaaatgtatatctccagatac
agttcagaacaaagtgctagacttctggactatgaggatggtagaggatcccgacatgca
tattcaacacaaagtgacacttcatatgataaccgagagagatccaaaagagattacaca
ccatcaaccaactctctagtgtctatggcatctaagttctccctgggacaaacagaactc
attcttcttttgatgtgttttattttagcactgtctcgatcaagtattggtagtataaaa
tgtttacaaacaactgaagaacctccttccagaactgcaggagccatgatgcaattcaca
gcccctattcccggagctacaggacctatcaagctctctcaaaaaaccattgtgcaaact
ccaggacctattgtacaatatcctggatccaatgctggtccaccttcagcaccccgcggt
ccacccatggcacccataataatttcacagagaaccgcaagaatacctcaagttcacact
atggacagttctggaaaaatcacactgactcctgtggttatattaacaggttacatggat
gaagaacttgcaaaaaaatcttgttccaaaatccagattctaaaatgtggaggcactgca
aggtctcagaatagccgagaagaaaacaaggaagcactaaagaatgacatcatatttacg
aattctgtagaatccttgaaatcagcacacataaaggagccagaaagagaaggaaaaggc
actgatttagagaaagacaaaataggaatggaggtcaaggtagacagtgacgctggaata
ccaaaaagacaggaaacccaactaaaaatcagtgagatgagtataccacaaggacaggga
gcccaaataaagaaaagtgtgtcagatgtaccaagaggacaggagtcccaagtaaagaag
agtgagtcaggtgtcccaaaaggacaagaagcccaagtaacgaagagtgggttggttgta
ctgaaaggacaggaagcccaggtagagaagagtgagatgggtgtgccaagaagacaggaa
tcccaagtaaagaagagtcagtctggtgtctcaaagggacaggaagcccaggtaaagaag
agggagtcagttgtactgaaaggacaggaagcccaggtagagaagagtgagttgaaggta
ccaaaaggacaagaaggccaagtagagaagactgaggcagatgtgccaaaggaacaagag
gtccaagaaaagaagagtgaggcaggtgtactgaaaggaccagaatcccaagtaaagaac
actgaggtgagtgtaccagaaacactggaatcccaagtaaagaagagtgagtcaggtgta
ctaaaaggacaggaagcccaagaaaagaaggagagttttgaggataaaggaaataatgat
aaagaaaaggagagagatgcagagaaagatccaaataaaaaagaaaaaggtgacaaaaac
acaaaaggtgacaaaggaaaggacaaagttaaaggaaagagagaatcagaaatcaatggt
gaaaaatcaaaaggctcgaaaagggcgaaggcaaatacaggaaggaagtacaacaaaaaa
gtggaagagtaa

DBGET integrated database retrieval system